Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-L1CAM AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit L1CAM Polyclonal Antibody | anti-L1CAM antibody

L1CAM antibody - C-terminal region

Gene Names
L1CAM; S10; HSAS; MASA; MIC5; SPG1; CAML1; CD171; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
L1CAM; Polyclonal Antibody; L1CAM antibody - C-terminal region; anti-L1CAM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGA
Sequence Length
1257
Applicable Applications for anti-L1CAM antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-L1CAM AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-L1CAM AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-L1CAM antibody
This is a rabbit polyclonal antibody against L1CAM. It was validated on Western Blot

Target Description: The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant.
Product Categories/Family for anti-L1CAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138kDa
NCBI Official Full Name
neural cell adhesion molecule L1 isoform 1
NCBI Official Synonym Full Names
L1 cell adhesion molecule
NCBI Official Symbol
L1CAM
NCBI Official Synonym Symbols
S10; HSAS; MASA; MIC5; SPG1; CAML1; CD171; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1
NCBI Protein Information
neural cell adhesion molecule L1
UniProt Protein Name
Neural cell adhesion molecule L1
UniProt Gene Name
L1CAM
UniProt Synonym Gene Names
CAML1; MIC5; N-CAM-L1; NCAM-L1
UniProt Entry Name
L1CAM_HUMAN

NCBI Description

The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons. [provided by RefSeq, May 2013]

Uniprot Description

NCAM-L1: cell adhesion molecule with an important role in the development of the nervous system. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons. Two splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: presynaptic membrane; cell surface; focal adhesion; plasma membrane; integral to membrane; terminal button; external side of plasma membrane

Molecular Function: integrin binding; identical protein binding; protein self-association; sialic acid binding

Biological Process: nervous system development; axon guidance; positive regulation of calcium-mediated signaling; chemotaxis; heterophilic cell adhesion; leukocyte adhesion; cell surface receptor linked signal transduction; homotypic cell-cell adhesion; cell-cell adhesion mediated by integrin; positive regulation of cell-cell adhesion; cell adhesion; blood coagulation; homophilic cell adhesion; leukocyte migration

Disease: Hydrocephalus Due To Congenital Stenosis Of Aqueduct Of Sylvius; Corpus Callosum, Partial Agenesis Of, X-linked; Masa Syndrome

Research Articles on L1CAM

Similar Products

Product Notes

The L1CAM l1cam (Catalog #AAA3215882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The L1CAM antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's L1CAM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the L1CAM l1cam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDIKPLGSDD SLADYGGSVD VQFNEDGSFI GQYSGKKEKE AAGGNDSSGA. It is sometimes possible for the material contained within the vial of "L1CAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.