Western Blot (WB)
(Host: RabbitTarget Name: SYTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SYTL3 Polyclonal Antibody | anti-SYTL3 antibody
SYTL3 Antibody - middle region
Gene Names
Sytl3; Slp3; Slp3-a; Slp3-b; mFLJ00307; A430092N21
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SYTL3; Polyclonal Antibody; SYTL3 Antibody - middle region; anti-SYTL3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLK
Sequence Length
412
Applicable Applications for anti-SYTL3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SYTL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SYTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SYTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SYTL3 antibody
May act as Rab effector protein and play a role in vesicle trafficking. Binds phospholipids in the presence of calcium ions.
Product Categories/Family for anti-SYTL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
synaptotagmin-like protein 3 isoform a
NCBI Official Synonym Full Names
synaptotagmin-like 3
NCBI Official Symbol
Sytl3
NCBI Official Synonym Symbols
Slp3; Slp3-a; Slp3-b; mFLJ00307; A430092N21
NCBI Protein Information
synaptotagmin-like protein 3
UniProt Protein Name
Synaptotagmin-like protein 3
Protein Family
UniProt Gene Name
Sytl3
UniProt Synonym Gene Names
Slp3
UniProt Entry Name
SYTL3_MOUSE
Research Articles on SYTL3
Similar Products
Product Notes
The SYTL3 sytl3 (Catalog #AAA3223804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYTL3 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SYTL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYTL3 sytl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CKNLAYGEEK KRKCNPYVKT YLLPDRSSQG KRKTRVQKNT LDPTFEETLK. It is sometimes possible for the material contained within the vial of "SYTL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
