Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MICA expression in transfected 293T cell line by MICA polyclonal antibody. Lane 1: MICA transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MICA Polyclonal Antibody | anti-MICA antibody

MICA (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1, FLJ60820, MGC111087) APC

Gene Names
MICA; MIC-A; PERB11.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MICA; Polyclonal Antibody; MICA (MHC Class I Polypeptide-related Sequence A; MIC-A; PERB11.1; FLJ60820; MGC111087) APC; anti-MICA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MICA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MICA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MICA, aa1-383 (NP_000238.1).
Immunogen Sequence
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MICA expression in transfected 293T cell line by MICA polyclonal antibody. Lane 1: MICA transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MICA expression in transfected 293T cell line by MICA polyclonal antibody. Lane 1: MICA transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MICA antibody
MICA encodes the highly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.
Product Categories/Family for anti-MICA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,577 Da
NCBI Official Full Name
MHC class I polypeptide-related sequence A isoform 1 (MICA*001)
NCBI Official Synonym Full Names
MHC class I polypeptide-related sequence A
NCBI Official Symbol
MICA
NCBI Official Synonym Symbols
MIC-A; PERB11.1
NCBI Protein Information
MHC class I polypeptide-related sequence A
UniProt Protein Name
MHC class I polypeptide-related sequence A
Protein Family
UniProt Gene Name
MICA
UniProt Synonym Gene Names
MIC-A
UniProt Entry Name
MICA_HUMAN

Uniprot Description

MICA: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T- cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Anti-MICA antibodies and ligand shedding are involved in the progression of monoclonal gammopathy of undetermined significance (MGUS)to multiple myeloma. Genetic variations in MICA may be a cause of susceptibility to psoriasis type 1 (PSORS1). Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis. Genetic variation in MICA is a cause of susceptibility to psoriatic arthritis (PSORAS). PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). Belongs to the MHC class I family. MIC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: extracellular space; cell surface; integral to plasma membrane; cytoplasm

Molecular Function: protein binding; beta-2-microglobulin binding; antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; viral reproduction; natural killer cell mediated cytotoxicity; response to heat; cytolysis; defense response to bacterium; immune response to tumor cell; gamma-delta T cell activation; response to DNA damage stimulus; defense response to virus; T cell mediated cytotoxicity

Disease: Psoriatic Arthritis, Susceptibility To; Psoriasis 1, Susceptibility To

Similar Products

Product Notes

The MICA mica (Catalog #AAA6385435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MICA (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1, FLJ60820, MGC111087) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MICA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MICA mica for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MICA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.