Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MGLL expression in transfected 293T cell line by MGLL polyclonal antibody. Lane 1: MGLL transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MGLL Polyclonal Antibody | anti-MGLL antibody

MGLL (Monoglyceride Lipase, MGL, HU-K5, Lysophospholipase Homolog, Lysophospholipase-like, Monoacylglycerol Lipase, MAGL) (PE)

Gene Names
MGLL; MGL; HUK5; MAGL; HU-K5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGLL; Polyclonal Antibody; MGLL (Monoglyceride Lipase; MGL; HU-K5; Lysophospholipase Homolog; Lysophospholipase-like; Monoacylglycerol Lipase; MAGL) (PE); anti-MGLL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MGLL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MGLL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MGLL, aa1-313 (NP_009214.1).
Immunogen Sequence
METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MGLL expression in transfected 293T cell line by MGLL polyclonal antibody. Lane 1: MGLL transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MGLL expression in transfected 293T cell line by MGLL polyclonal antibody. Lane 1: MGLL transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MGLL antibody
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
Product Categories/Family for anti-MGLL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,149 Da
NCBI Official Full Name
monoglyceride lipase isoform 1
NCBI Official Synonym Full Names
monoglyceride lipase
NCBI Official Symbol
MGLL
NCBI Official Synonym Symbols
MGL; HUK5; MAGL; HU-K5
NCBI Protein Information
monoglyceride lipase; monoacylglycerol lipase; lysophospholipase homolog
UniProt Protein Name
Monoglyceride lipase
Protein Family
UniProt Gene Name
MGLL
UniProt Synonym Gene Names
MGL; MAGL
UniProt Entry Name
MGLL_HUMAN

NCBI Description

This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

MGLL: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.

Protein type: Lipid Metabolism - glycerolipid; EC 3.1.1.23; Phospholipase

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; extrinsic to membrane; plasma membrane; synapse; cytosol

Molecular Function: protein homodimerization activity; acylglycerol lipase activity; lipid binding; lysophospholipase activity

Biological Process: platelet activation; phospholipid metabolic process; regulation of inflammatory response; glycerophospholipid biosynthetic process; triacylglycerol catabolic process; regulation of signal transduction; arachidonic acid metabolic process; regulation of axon extension; lipid metabolic process; regulation of sensory perception of pain; inflammatory response; blood coagulation; fatty acid biosynthetic process; acylglycerol catabolic process

Research Articles on MGLL

Similar Products

Product Notes

The MGLL mgll (Catalog #AAA6385367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGLL (Monoglyceride Lipase, MGL, HU-K5, Lysophospholipase Homolog, Lysophospholipase-like, Monoacylglycerol Lipase, MAGL) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGLL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGLL mgll for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGLL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.