Rabbit anti-Human MGLL Polyclonal Antibody | anti-MGLL antibody

MGLL (Monoglyceride Lipase, MGL, HU-K5, Lysophospholipase Homolog, Lysophospholipase-like, Monoacylglycerol Lipase, MAGL) (HRP)

Cat. Num. AAA6385361

• Gene Names: MGLL; MGL; HUK5; MAGL; HU-K5
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MGLL; Polyclonal Antibody; MGLL (Monoglyceride Lipase; MGL; HU-K5; Lysophospholipase Homolog; Lysophospholipase-like; Monoacylglycerol Lipase; MAGL) (HRP); anti-MGLL antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MGLL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-MGLL antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MGLL, aa1-313 (NP_009214.1).
• Immunogen Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MGLL expression in transfected 293T cell line by MGLL polyclonal antibody. Lane 1: MGLL transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MGLL antibody

Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.

Product Categories/Family for anti-MGLL antibody

Antibodies; Enzymes; Lipase

NCBI and Uniprot Product Information

• NCBI GI #: 6005786
• NCBI GeneID: 11343
• NCBI Accession #: NP_009214.1
• NCBI GenBank Nucleotide #: NM_007283.5
• UniProt Accession #: Q99685; Q6IBG9; Q96AA5; B3KRC2; B7Z9D1
• Molecular Weight: 31,149 Da
• NCBI Official Full Name: monoglyceride lipase isoform 1
• NCBI Official Synonym Full Names: monoglyceride lipase
• NCBI Official Symbol: MGLL
• NCBI Official Synonym Symbols: MGL; HUK5; MAGL; HU-K5
• NCBI Protein Information: monoglyceride lipase; monoacylglycerol lipase; lysophospholipase homolog
• UniProt Protein Name: Monoglyceride lipase
• Protein Family: Monoglyceride lipase
• UniProt Gene Name: MGLL
• UniProt Synonym Gene Names: MGL; MAGL
• UniProt Entry Name: MGLL_HUMAN

NCBI Description

This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

MGLL: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.

Protein type: Lipid Metabolism - glycerolipid; EC 3.1.1.23; Phospholipase

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; extrinsic to membrane; plasma membrane; synapse; cytosol

Molecular Function: protein homodimerization activity; acylglycerol lipase activity; lipid binding; lysophospholipase activity

Biological Process: platelet activation; phospholipid metabolic process; regulation of inflammatory response; glycerophospholipid biosynthetic process; triacylglycerol catabolic process; regulation of signal transduction; arachidonic acid metabolic process; regulation of axon extension; lipid metabolic process; regulation of sensory perception of pain; inflammatory response; blood coagulation; fatty acid biosynthetic process; acylglycerol catabolic process