Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MFNG antibody (MBS5301375) used at 0.25 ug/ml to detect target protein.)

Rabbit MFNG Polyclonal Antibody | anti-MFNG antibody

MFNG antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
MFNG; Polyclonal Antibody; MFNG antibody; Polyclonal MFNG; Anti-MFNG; Mfng O-Fucosylpeptide 3-Beta-N-Acetylglucosaminyltransferase; anti-MFNG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
MFNG antibody was raised against the middle region of MFNG
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFNG antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
321
Applicable Applications for anti-MFNG antibody
Western Blot (WB)
Application Notes
WB: 0.25 ug/ml
Biological Significance
MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(MFNG antibody (MBS5301375) used at 0.25 ug/ml to detect target protein.)

Western Blot (WB) (MFNG antibody (MBS5301375) used at 0.25 ug/ml to detect target protein.)
Related Product Information for anti-MFNG antibody
Rabbit polyclonal MFNG antibody raised against the middle region of MFNG
Product Categories/Family for anti-MFNG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
MFNG
NCBI Official Synonym Full Names
MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
NCBI Official Symbol
MFNG
NCBI Protein Information
beta-1,3-N-acetylglucosaminyltransferase manic fringe
UniProt Protein Name
Beta-1,3-N-acetylglucosaminyltransferase manic fringe
UniProt Gene Name
MFNG
UniProt Entry Name
MFNG_HUMAN

NCBI Description

This gene is a member of the fringe gene family which also includes radical and lunatic fringe genes. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq, Oct 2009]

Uniprot Description

MFNG: Glycosyltransferase involved in the elongation of O- linked ligands to activate Notch signaling. Possesses fucose- specific beta-1,3-N-acetylglucosaminyltransferase activity. Belongs to the glycosyltransferase 31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 2.4.1.222; Transferase

Chromosomal Location of Human Ortholog: 22q12

Cellular Component: extracellular space; integral to Golgi membrane

Molecular Function: metal ion binding; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

Biological Process: positive regulation of protein binding; metabolic process; pattern specification process; positive regulation of Notch signaling pathway

Research Articles on MFNG

Similar Products

Product Notes

The MFNG mfng (Catalog #AAA5301375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFNG antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MFNG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.25 ug/ml. Researchers should empirically determine the suitability of the MFNG mfng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MFNG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.