Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LOC399818 polyclonal antibody. Western Blot analysis of LOC399818 expression in human kidney.)

Mouse anti-Human METTL10 Polyclonal Antibody | anti-METTL10 antibody

METTL10 (Methyltransferase-like Protein 10, C10orf138, FLJ13019)

Gene Names
METTL10; C10orf138; Em:AC068896.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
METTL10; Polyclonal Antibody; METTL10 (Methyltransferase-like Protein 10; C10orf138; FLJ13019); Anti -METTL10 (Methyltransferase-like Protein 10; anti-METTL10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human METTL10.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM
Applicable Applications for anti-METTL10 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human METTL10, aa1-192 (AAH26167.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LOC399818 polyclonal antibody. Western Blot analysis of LOC399818 expression in human kidney.)

Western Blot (WB) (LOC399818 polyclonal antibody. Western Blot analysis of LOC399818 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of METTL10 expression in transfected 293T cell line by METTL10 polyclonal antibody. Lane 1: LOC399818 transfected lysate (21.12kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of METTL10 expression in transfected 293T cell line by METTL10 polyclonal antibody. Lane 1: LOC399818 transfected lysate (21.12kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-METTL10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,830 Da
NCBI Official Full Name
methyltransferase-like protein 10
NCBI Official Synonym Full Names
methyltransferase like 10
NCBI Official Symbol
METTL10
NCBI Official Synonym Symbols
C10orf138; Em:AC068896.3
NCBI Protein Information
methyltransferase-like protein 10
UniProt Protein Name
Methyltransferase-like protein 10
UniProt Gene Name
METTL10
UniProt Synonym Gene Names
C10orf138
UniProt Entry Name
MET10_HUMAN

Uniprot Description

METTL10: Belongs to the methyltransferase superfamily.

Protein type: EC 2.1.1.-; Methyltransferase, protein arginine; Methyltransferase

Chromosomal Location of Human Ortholog: 10q26.13

Molecular Function: methyltransferase activity

Biological Process: methylation

Research Articles on METTL10

Similar Products

Product Notes

The METTL10 mettl10 (Catalog #AAA6002437) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The METTL10 (Methyltransferase-like Protein 10, C10orf138, FLJ13019) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's METTL10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the METTL10 mettl10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSGADGGGG AAVAARSDKG SPGEDGFVPS ALGTREHWDA VYERELQTFR EYGDTGEIWF GEESMNRLIR WMQKHKIPLD ASVLDIGTGN GVFLVELAKF GFSNITGIDY SPSAIQLSGS IIEKEGLSNI KLKVEDFLNL STQLSGFHIC IDKGTFDAIS LNPDNAIEKR KQYVKSLSRV LKVKGFFSNN VM. It is sometimes possible for the material contained within the vial of "METTL10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.