Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAP1D expression in transfected 293T cell line by MAP1D polyclonal antibody. Lane 1: MAP1D transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human METAP1D Polyclonal Antibody | anti-METAP1D antibody

METAP1D (Methionine Aminopeptidase 1D, Mitochondrial, Methionyl Aminopeptidase Type 1D, Mitochondrial, MAP1D)

Gene Names
METAP1D; MAP1D; MAP 1D; Metap1l; MetAP 1D
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
METAP1D; Polyclonal Antibody; METAP1D (Methionine Aminopeptidase 1D; Mitochondrial; Methionyl Aminopeptidase Type 1D; MAP1D); Anti -METAP1D (Methionine Aminopeptidase 1D; anti-METAP1D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAP1D.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
Applicable Applications for anti-METAP1D antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MAP1D, aa1-335 (NP_954697).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAP1D expression in transfected 293T cell line by MAP1D polyclonal antibody. Lane 1: MAP1D transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAP1D expression in transfected 293T cell line by MAP1D polyclonal antibody. Lane 1: MAP1D transfected lysate (36.85kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-METAP1D antibody
Removes The N-Terminal Methionine From Nascent Proteins. May Play A Role In Colon Tumorigenesis.
Product Categories/Family for anti-METAP1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,088 Da
NCBI Official Full Name
methionine aminopeptidase 1D, mitochondrial
NCBI Official Synonym Full Names
methionyl aminopeptidase type 1D (mitochondrial)
NCBI Official Symbol
METAP1D
NCBI Official Synonym Symbols
MAP1D; MAP 1D; Metap1l; MetAP 1D
NCBI Protein Information
methionine aminopeptidase 1D, mitochondrial; peptidase M 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial
UniProt Protein Name
Methionine aminopeptidase 1D, mitochondrial
UniProt Gene Name
METAP1D
UniProt Synonym Gene Names
MAP1D; MAP 1D; MetAP 1D
UniProt Entry Name
MAP12_HUMAN

NCBI Description

The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed

By similarity. May play a role in colon tumorigenesis. Ref.2

Catalytic activity: Release of N-terminal amino acids, preferentially methionine, from peptides and arylamides. HAMAP-Rule MF_03174

Cofactor: Binds 2 divalent metal cations per subunit. Has a high-affinity and a low affinity metal-binding site. The true nature of the physiological cofactor is under debate. The enzyme is active with cobalt, zinc, manganese or divalent iron ions. Most likely, methionine aminopeptidases function as mononuclear Fe2+-metalloproteases under physiological conditions, and the catalytically relevant metal-binding site has been assigned to the histidine-containing high-affinity site

By similarity. Ref.5

Subcellular location: Mitochondrion Ref.1.

Tissue specificity: Overexpressed in colon cancer cell lines and colon tumors as compared to normal tissues (at protein level). Ref.2

Sequence similarities: Belongs to the peptidase M24A family. Methionine aminopeptidase type 1 subfamily.

Caution: It is uncertain whether Met-1 or a Met upstream of this sequence is the initiator.

Biophysicochemical propertiesKinetic parameters:KM=573 µM for Met-pro-p-nitroanilide (at pH 8) Ref.5pH dependence:Optimum pH is 7.5-8.0.

Sequence caution: The sequence AAY55948.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on METAP1D

Similar Products

Product Notes

The METAP1D metap1d (Catalog #AAA646250) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The METAP1D (Methionine Aminopeptidase 1D, Mitochondrial, Methionyl Aminopeptidase Type 1D, Mitochondrial, MAP1D) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's METAP1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the METAP1D metap1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPSGVHLL VRRGSHRIFS SPLNHIYLHK QSSSQQRRNF FFRRQRDISH SIVLPAAVSS AHPVPKHIKK PDYVTTGIVP DWGDSIEVKN EDQIQGLHQA CQLARHVLLL AGKSLKVDMT TEEIDALVHR EIISHNAYPS PLGYGGFPKS VCTSVNNVLC HGIPDSRPLQ DGDIINIDVT VYYNGYHGDT SETFLVGNVD ECGKKLVEVA RRCRDEAIAA CRAGAPFSVI GNTISHITHQ NGFQVCPHFV GHGIGSYFHG HPEIWHHAND SDLPMEEGMA FTIEPIITEG SPEFKVLEDA WTVVSLDNQR SAQFEHTVLI TSRGAQILTK LPHEA. It is sometimes possible for the material contained within the vial of "METAP1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.