Western Blot (WB)
(Host: RabbitTarget Name: METAP1DSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit METAP1D Polyclonal Antibody | anti-METAP1D antibody
METAP1D Antibody - N-terminal region
Gene Names
METAP1D; MAP1D; MAP 1D; Metap1l; MetAP 1D
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
METAP1D; Polyclonal Antibody; METAP1D Antibody - N-terminal region; anti-METAP1D antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPD
Sequence Length
335
Applicable Applications for anti-METAP1D antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human METAP1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: METAP1DSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: METAP1DSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-METAP1D antibody
This is a rabbit polyclonal antibody against METAP1D. It was validated on Western Blot
Target Description: The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases.
Target Description: The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases.
Product Categories/Family for anti-METAP1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
methionine aminopeptidase 1D, mitochondrial isoform 1
NCBI Official Synonym Full Names
methionyl aminopeptidase type 1D, mitochondrial
NCBI Official Symbol
METAP1D
NCBI Official Synonym Symbols
MAP1D; MAP 1D; Metap1l; MetAP 1D
NCBI Protein Information
methionine aminopeptidase 1D, mitochondrial
UniProt Protein Name
Methionine aminopeptidase 1D, mitochondrial
UniProt Gene Name
METAP1D
UniProt Entry Name
MAP12_HUMAN
NCBI Description
The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methionine aminopeptidases (MetAps, or MAPs; EC 3.4.11.18) (Serero et al., 2003 [PubMed 14532271]).[supplied by OMIM, Mar 2008]
Uniprot Description
MAP1D: Removes the N-terminal methionine from nascent proteins. May play a role in colon tumorigenesis. Belongs to the peptidase M24A family.
Protein type: EC 3.4.11.18; Protease; Mitochondrial
Chromosomal Location of Human Ortholog: 2q31.1
Cellular Component: mitochondrion
Molecular Function: metalloexopeptidase activity; metal ion binding; aminopeptidase activity
Biological Process: peptidyl-methionine modification; proteolysis; N-terminal protein amino acid modification
Research Articles on METAP1D
Similar Products
Product Notes
The METAP1D metap1d (Catalog #AAA3218212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The METAP1D Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's METAP1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the METAP1D metap1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNHIYLHKQS SSQQRRNFFF RRQRDISHSI VLPAAVSSAH PVPKHIKKPD. It is sometimes possible for the material contained within the vial of "METAP1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
