Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type :HeLa cellsPrimary Antibody Dilution :1:50Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: MFI2Blue: DAPIGene Name :MFI2Submitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Rabbit MELTF Polyclonal Antibody | anti-MELTF antibody

MELTF Antibody - C-terminal region

Gene Names
MELTF; MTf; MFI2; MTF1; CD228; MAP97
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
MELTF; Polyclonal Antibody; MELTF Antibody - C-terminal region; anti-MELTF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
Sequence Length
738
Applicable Applications for anti-MELTF antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MFI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type :HeLa cellsPrimary Antibody Dilution :1:50Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: MFI2Blue: DAPIGene Name :MFI2Submitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Immunofluorescence (IF) (Sample Type :HeLa cellsPrimary Antibody Dilution :1:50Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: MFI2Blue: DAPIGene Name :MFI2Submitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Western Blot (WB)

(WB Suggested Anti-MFI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MFI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-MELTF antibody
This is a rabbit polyclonal antibody against MFI2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified. This gene resides in the same region of chromosome 3 as members of the transferrin superfamily. Alternative splicing results in two transcript variants.
Product Categories/Family for anti-MELTF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
melanotransferrin isoform 1 preproprotein
NCBI Official Synonym Full Names
melanotransferrin
NCBI Official Symbol
MELTF
NCBI Official Synonym Symbols
MTf; MFI2; MTF1; CD228; MAP97
NCBI Protein Information
melanotransferrin
UniProt Protein Name
Melanotransferrin
Protein Family
UniProt Gene Name
MFI2
UniProt Synonym Gene Names
MAP97
UniProt Entry Name
TRFM_HUMAN

NCBI Description

The protein encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified. This gene resides in the same region of chromosome 3 as members of the transferrin superfamily. Alternative splicing results in two transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

MFI2: Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc. Belongs to the transferrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 3q28-q29

Cellular Component: cell surface; anchored to plasma membrane; integral to plasma membrane

Molecular Function: protein binding; ferric iron binding; iron ion binding

Biological Process: cellular iron ion homeostasis; regulation of cell growth; regulation of cell proliferation

Research Articles on MELTF

Similar Products

Product Notes

The MELTF mfi2 (Catalog #AAA3214750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MELTF Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MELTF can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the MELTF mfi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CVPVNNPKNY PSSLCALCVG DEQGRNKCVG NSQERYYGYR GAFRCLVENA. It is sometimes possible for the material contained within the vial of "MELTF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.