Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: SRCSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit SRC Polyclonal Antibody | anti-SRC antibody

SRC antibody - N-terminal region

Gene Names
SRC; ASV; SRC1; THC6; c-SRC; p60-Src
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SRC; Polyclonal Antibody; SRC antibody - N-terminal region; anti-SRC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG
Sequence Length
536
Applicable Applications for anti-SRC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: SRCSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SRCSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: MouseTarget Name: SRCSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SRCSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-SRC antibody
This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot

Target Description: This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
proto-oncogene tyrosine-protein kinase Src
NCBI Official Synonym Full Names
SRC proto-oncogene, non-receptor tyrosine kinase
NCBI Official Symbol
SRC
NCBI Official Synonym Symbols
ASV; SRC1; THC6; c-SRC; p60-Src
NCBI Protein Information
proto-oncogene tyrosine-protein kinase Src
UniProt Protein Name
Proto-oncogene tyrosine-protein kinase Src
Protein Family
UniProt Gene Name
SRC
UniProt Synonym Gene Names
SRC1; p60-Src
UniProt Entry Name
SRC_HUMAN

NCBI Description

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Src: proto-oncogenic cytoplasmic tyrosine kinase of the SRC family. Highly expressed in certain fully differentiated cells such as neurons, platelets and macrophages. Phosphorylation of an activation loop tyrosine activates the enzyme; phosphorylation of a tyrosine in the C-terminus by Csk inhibits the enzyme. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, TK; EC 2.7.10.2; Kinase, protein; Oncoprotein; Protein kinase, tyrosine (non-receptor); TK group; Src family

Chromosomal Location of Human Ortholog: 20q12-q13

Cellular Component: neuron projection; mitochondrion; lysosome; postsynaptic density; actin filament; caveola; cytosol; extrinsic to internal side of plasma membrane; perinuclear region of cytoplasm; late endosome; mitochondrial inner membrane; cytoplasm; plasma membrane; nucleus

Molecular Function: protein C-terminus binding; ephrin receptor binding; non-membrane spanning protein tyrosine kinase activity; phosphoprotein binding; insulin receptor binding; protein kinase activity; integrin binding; protein binding; enzyme binding; SH3/SH2 adaptor activity; protein kinase C binding; protein-tyrosine kinase activity; heme binding; estrogen receptor binding; SH2 domain binding; kinase activity; ATP binding; hormone receptor binding; receptor binding

Biological Process: oogenesis; regulation of estrogen receptor signaling pathway; progesterone receptor signaling pathway; central nervous system development; positive regulation of cyclin-dependent protein kinase activity; estrogen receptor signaling pathway; viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; regulation of cell cycle; positive regulation of transcription, DNA-dependent; uterus development; negative regulation of mitochondrial depolarization; negative regulation of protein homooligomerization; positive regulation of MAP kinase activity; cell-cell adhesion; transforming growth factor beta receptor signaling pathway; cell adhesion; response to electrical stimulus; bone resorption; response to drug; platelet activation; fibroblast growth factor receptor signaling pathway; activation of protein kinase B; response to virus; transcytosis; positive regulation of integrin activation; positive regulation of protein amino acid autophosphorylation; cellular response to insulin stimulus; response to mechanical stimulus; T cell costimulation; regulation of vascular permeability; negative regulation of transcription, DNA-dependent; leukocyte migration; negative regulation of apoptosis; axon guidance; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; platelet-derived growth factor receptor signaling pathway; negative regulation of caspase activity; signal transduction; positive regulation of smooth muscle cell migration; regulation of cell-cell adhesion; forebrain development; ephrin receptor signaling pathway; epidermal growth factor receptor signaling pathway; integrin-mediated signaling pathway; response to nutrient levels; regulation of bone resorption; negative regulation of focal adhesion formation; signal complex assembly; positive regulation of phosphoinositide 3-kinase activity; response to mineralocorticoid stimulus; cell cycle; regulation of cell proliferation; cell proliferation; positive regulation of protein kinase B signaling cascade; peptidyl-serine phosphorylation; response to hydrogen peroxide; regulation of protein binding; Ras protein signal transduction; stress fiber formation; innate immune response; response to acidity; positive regulation of insulin receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway; blood coagulation; positive regulation of cytokine secretion

Research Articles on SRC

Similar Products

Product Notes

The SRC src (Catalog #AAA3200966) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SRC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRC src for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTPSKPASAD GHRGPSAAFA PAAAEPKLFG GFNSSDTVTS PQRAGPLAGG. It is sometimes possible for the material contained within the vial of "SRC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.