Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- MCM8 Picoband antibody, MBS178026, Western blottingAll lanes: Anti MCM8 (MBS178026) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 94KDObserved bind size: 94KD)

anti-Human MCM8 Polyclonal Antibody | anti-MCM8 antibody

Anti-MCM8 Antibody

Gene Names
MCM8; POF10; C20orf154; dJ967N21.5
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MCM8; Polyclonal Antibody; Anti-MCM8 Antibody; DNA helicase MCM8; C20orf154; dJ967N21.5; DNA replication licensing factor MCM8; MCM8_HUMAN; MGC119522; MGC119523; MGC12866; MGC4816; Minichromosome maintenance 8; Minichromosome maintenance complex component 8; REC; minichromosome maintenance 8 homologous recombination repair factor; anti-MCM8 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
840
Applicable Applications for anti-MCM8 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MCM8 Picoband antibody, MBS178026, Western blottingAll lanes: Anti MCM8 (MBS178026) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 94KDObserved bind size: 94KD)

Western Blot (WB) (Anti- MCM8 Picoband antibody, MBS178026, Western blottingAll lanes: Anti MCM8 (MBS178026) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 94KDObserved bind size: 94KD)
Related Product Information for anti-MCM8 antibody
Description: Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.

Background: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
References
1. "Entrez Gene: MCM8 MCM8 minichromosome maintenance deficient 8 (S. cerevisiae)". 2. Gozuacik D, Chami M, Lagorce D, Faivre J, Murakami Y, Poch O, Biermann E, Knippers R, Brechot C, Paterlini-Brechot P (Jan 2003). "Identification and functional characterization of a new member of the human Mcm protein family: hMcm8". Nucleic Acids Res 31 (2): 570-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,932 Da
NCBI Official Full Name
DNA helicase MCM8 isoform 1
NCBI Official Synonym Full Names
minichromosome maintenance 8 homologous recombination repair factor
NCBI Official Symbol
MCM8
NCBI Official Synonym Symbols
POF10; C20orf154; dJ967N21.5
NCBI Protein Information
DNA helicase MCM8
UniProt Protein Name
DNA helicase MCM8
Protein Family
UniProt Gene Name
MCM8
UniProt Synonym Gene Names
C20orf154
UniProt Entry Name
MCM8_HUMAN

NCBI Description

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the mini-chromosome maintenance proteins is a key component of the pre-replication complex and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the mini-chromosome maintenance proteins. The encoded protein may interact with other mini-chromosome maintenance proteins and play a role in DNA replication. This gene may be associated with length of reproductive lifespan and menopause. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013]

Uniprot Description

MCM8: Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8- MCM9 complex probably acts as a hexameric helicase downstream of the Fanconi anemia proteins BRCA2 and RAD51 and is required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart. May also play a non-essential for DNA replication: may be involved in the activation of the prereplicative complex (pre-RC) during G(1) phase by recruiting CDC6 to the origin recognition complex (ORC). Binds chromatin throughout the cell cycle. Belongs to the MCM family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 20p12.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: ATP binding; DNA binding; helicase activity; protein binding

Biological Process: DNA replication; double-strand break repair via homologous recombination; female gamete generation; G1/S transition of mitotic cell cycle; male gamete generation; response to DNA damage stimulus

Disease: Premature Ovarian Failure 10

Research Articles on MCM8

Similar Products

Product Notes

The MCM8 mcm8 (Catalog #AAA178026) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MCM8 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCM8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MCM8 mcm8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCM8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.