Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MCL1Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MCL1 Polyclonal Antibody | anti-MCL1 antibody

MCL1 Antibody - middle region

Gene Names
MCL1; TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MCL1; Polyclonal Antibody; MCL1 Antibody - middle region; anti-MCL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHET
Sequence Length
350
Applicable Applications for anti-MCL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MCL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MCL1Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MCL1Sample Tissue: Human RPMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MCL1 antibody
This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.
Product Categories/Family for anti-MCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
induced myeloid leukemia cell differentiation protein Mcl-1 isoform 3
NCBI Official Synonym Full Names
MCL1 apoptosis regulator, BCL2 family member
NCBI Official Symbol
MCL1
NCBI Official Synonym Symbols
TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT
NCBI Protein Information
induced myeloid leukemia cell differentiation protein Mcl-1
UniProt Protein Name
Induced myeloid leukemia cell differentiation protein Mcl-1
UniProt Gene Name
MCL1
UniProt Synonym Gene Names
BCL2L3; Bcl2-L-3
UniProt Entry Name
MCL1_HUMAN

NCBI Description

This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing. [provided by RefSeq, Oct 2010]

Uniprot Description

MCL1: a myeloid cell leukemia protein of the Bcl-2 family of proteins. Two alternatively spliced transcripts encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing.

Protein type: Membrane protein, integral; Mitochondrial; Channel, misc.; Inhibitor; Apoptosis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; mitochondrial outer membrane; mitochondrion; membrane; mitochondrial matrix; cytoplasm; integral to membrane; cytosol; nucleus

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity; protein channel activity; BH3 domain binding

Biological Process: apoptotic mitochondrial changes; DNA damage response, signal transduction resulting in induction of apoptosis; response to cytokine stimulus; multicellular organismal development; cellular homeostasis; cell fate determination

Research Articles on MCL1

Similar Products

Product Notes

The MCL1 mcl1 (Catalog #AAA3223465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MCL1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MCL1 mcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSLEIISRYL REQATGAKDT KPMGRSGATS RKALETLRRV GDGVQRNHET. It is sometimes possible for the material contained within the vial of "MCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.