Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Mouse anti-Human LAT2 Monoclonal Antibody | anti-LAT2 antibody

LAT2 (Large Neutral Amino Acids Transporter Small Subunit 2, L-type Amino Acid Transporter 2, hLAT2, Solute Carrier Family 7 Member 8, SLC7A8) (FITC)

Gene Names
SLC7A8; LAT2; LPI-PC1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LAT2; Monoclonal Antibody; LAT2 (Large Neutral Amino Acids Transporter Small Subunit 2; L-type Amino Acid Transporter 2; hLAT2; Solute Carrier Family 7 Member 8; SLC7A8) (FITC); anti-LAT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F10
Specificity
Recognizes human SLC7A8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-LAT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa467-536 from SLC7A8 (NP_036376) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC7A8 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC7A8 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-LAT2 antibody
Sodium-independent, high-affinity transport of small and large neutral aa such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney.
Product Categories/Family for anti-LAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,283 Da
NCBI Official Full Name
large neutral amino acids transporter small subunit 2 isoform a
NCBI Official Synonym Full Names
solute carrier family 7 (amino acid transporter light chain, L system), member 8
NCBI Official Symbol
SLC7A8
NCBI Official Synonym Symbols
LAT2; LPI-PC1
NCBI Protein Information
large neutral amino acids transporter small subunit 2
UniProt Protein Name
Large neutral amino acids transporter small subunit 2
UniProt Gene Name
SLC7A8
UniProt Synonym Gene Names
LAT2; hLAT2
UniProt Entry Name
LAT2_HUMAN

Uniprot Description

SLC7A8: Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney. Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: basolateral plasma membrane; cytoplasm; integral to plasma membrane; plasma membrane

Molecular Function: amino acid transmembrane transporter activity; antiporter activity; L-amino acid transmembrane transporter activity; neutral amino acid transmembrane transporter activity; organic cation transmembrane transporter activity; peptide antigen binding; protein binding; toxin transporter activity

Biological Process: amino acid metabolic process; amino acid transport; blood coagulation; ion transport; leukocyte migration; metal ion homeostasis; neutral amino acid transport; organic cation transport; response to toxin; transmembrane transport; transport

Research Articles on LAT2

Similar Products

Product Notes

The LAT2 slc7a8 (Catalog #AAA6147976) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LAT2 (Large Neutral Amino Acids Transporter Small Subunit 2, L-type Amino Acid Transporter 2, hLAT2, Solute Carrier Family 7 Member 8, SLC7A8) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAT2 slc7a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.