Western Blot (WB)
(MCART1 polyclonal antibody. Western Blot analysis of MCART1 expression in human kidney.)
Mouse anti-Human MCART1 Polyclonal Antibody | anti-SLC25A51 antibody
MCART1 (SLC25A51, Solute Carrier Family 25 Member 51, Mitochondrial Carrier Triple Repeat Protein 1, CG7943, FLJ37273, MGC14836)
Gene Names
SLC25A51; CG7943; MCART1
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MCART1; Polyclonal Antibody; MCART1 (SLC25A51; Solute Carrier Family 25 Member 51; Mitochondrial Carrier Triple Repeat Protein 1; CG7943; FLJ37273; MGC14836); Anti -MCART1 (SLC25A51; anti-SLC25A51 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MCART1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI
Applicable Applications for anti-SLC25A51 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MCART1, aa1-297 (NP_219480.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MCART1 polyclonal antibody. Western Blot analysis of MCART1 expression in human kidney.)
Western Blot (WB)
(MCART1 polyclonal antibody. Western Blot analysis of MCART1 expression in human kidney.)
Western Blot (WB)
(Western Blot analysis of MCART1 expression in transfected 293T cell line by MCART1 polyclonal antibody. Lane 1: MCART1 transfected lysate (32.67kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MCART1 expression in transfected 293T cell line by MCART1 polyclonal antibody. Lane 1: MCART1 transfected lysate (32.67kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLC25A51 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,672 Da
NCBI Official Full Name
MCART1 protein
NCBI Official Synonym Full Names
solute carrier family 25, member 51
NCBI Official Symbol
SLC25A51
NCBI Official Synonym Symbols
CG7943; MCART1
NCBI Protein Information
solute carrier family 25 member 51; mitochondrial carrier triple repeat 1; mitochondrial carrier triple repeat protein 1
UniProt Protein Name
Solute carrier family 25 member 51
Protein Family
UniProt Gene Name
SLC25A51
UniProt Synonym Gene Names
MCART1
UniProt Entry Name
S2551_HUMAN
Uniprot Description
MCART1: Belongs to the mitochondrial carrier family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 9p13.3-p12
Cellular Component: mitochondrial inner membrane; integral to membrane
Biological Process: transport
Research Articles on SLC25A51
Similar Products
Product Notes
The SLC25A51 slc25a51 (Catalog #AAA6009866) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCART1 (SLC25A51, Solute Carrier Family 25 Member 51, Mitochondrial Carrier Triple Repeat Protein 1, CG7943, FLJ37273, MGC14836) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCART1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLC25A51 slc25a51 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMDSEAHEKR PPILTSSKQD ISPHITNVGE MKHYLCGCCA AFNNVAITFP IQKVLFRQQL YGIKTRDAIL QLRRDGFRNL YRGILPPLMQ KTTTLALMFG LYEDLSCLLH KHVSAPEFAT SGVAAVLAGT TEAIFTPLER VQTLLQDHKH HDKFTNTYQA FKALKCHGIG EYYRGLVPIL FRNGLSNVLF FGLRGPIKEH LPTATTHSAH LVNDFICGGL LGAMLGFLFF PINVVKTRIQ SQIGGEFQSF PKVFQKIWLE RDRKLINLFR GAHLNYHRSL ISWGIINATY EFLLKVI. It is sometimes possible for the material contained within the vial of "MCART1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
