Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EIF4E2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit EIF4E2 Polyclonal Antibody | anti-EIF4E2 antibody

EIF4E2 antibody - N-terminal region

Gene Names
EIF4E2; 4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF4E2; Polyclonal Antibody; EIF4E2 antibody - N-terminal region; anti-EIF4E2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG
Sequence Length
245
Applicable Applications for anti-EIF4E2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EIF4E2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EIF4E2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: EIF4E2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that EIF4E2 is expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: EIF4E2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that EIF4E2 is expressed in Jurkat)

Western Blot (WB)

(WB Suggested Anti-EIF4E2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateEIF4E2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-EIF4E2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateEIF4E2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-EIF4E2 antibody
This is a rabbit polyclonal antibody against EIF4E2. It was validated on Western Blot

Target Description: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4E type 2 isoform A
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E family member 2
NCBI Official Symbol
EIF4E2
NCBI Official Synonym Symbols
4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3
NCBI Protein Information
eukaryotic translation initiation factor 4E type 2
UniProt Protein Name
Eukaryotic translation initiation factor 4E type 2
UniProt Gene Name
EIF4E2
UniProt Synonym Gene Names
EIF4EL3; eIF-4E type 2; eIF4E type 2
UniProt Entry Name
IF4E2_HUMAN

Uniprot Description

EIF4E2: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. eIF4F is a multi-subunit complex, the composition of which varies with external and internal environmental conditions. It is composed of at least eIF4A, eIF4E and eIF4G. eIF4E is also known to interact with other partners. EIF4E2 interacts with EIF4EBP1, EIF4EBP2 and EIF4EBP3 but not with eIF4G. Belongs to the eukaryotic initiation factor 4E family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: mRNA cap complex; cytosol

Molecular Function: protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity; ubiquitin protein ligase binding; RNA cap binding

Biological Process: in utero embryonic development; cytokine and chemokine mediated signaling pathway; negative regulation of translation; translational initiation

Research Articles on EIF4E2

Similar Products

Product Notes

The EIF4E2 eif4e2 (Catalog #AAA3214099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF4E2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4E2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF4E2 eif4e2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNNKFDALKD DDSGDHDQNE ENSTQKDGEK EKTERDKNQS SSKRKAVVPG. It is sometimes possible for the material contained within the vial of "EIF4E2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.