Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PATZ1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit PATZ1 Polyclonal Antibody | anti-PATZ1 antibody

PATZ1 antibody - N-terminal region

Gene Names
PATZ1; ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PATZ1; Polyclonal Antibody; PATZ1 antibody - N-terminal region; anti-PATZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDE
Sequence Length
687
Applicable Applications for anti-PATZ1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PATZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PATZ1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PATZ1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PATZ1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PATZ1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateThere is BioGPS gene expression data showing that PATZ1 is expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateThere is BioGPS gene expression data showing that PATZ1 is expressed in HT1080)
Related Product Information for anti-PATZ1 antibody
This is a rabbit polyclonal antibody against PATZ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PATZ1 contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
POZ-, AT hook-, and zinc finger-containing protein 1 long C isoform
NCBI Official Synonym Full Names
POZ/BTB and AT hook containing zinc finger 1
NCBI Official Symbol
PATZ1
NCBI Official Synonym Symbols
ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
NCBI Protein Information
POZ-, AT hook-, and zinc finger-containing protein 1
UniProt Protein Name
POZ-, AT hook-, and zinc finger-containing protein 1
UniProt Gene Name
PATZ1
UniProt Synonym Gene Names
PATZ; RIAZ; ZBTB19; ZNF278; ZSG
UniProt Entry Name
PATZ1_HUMAN

NCBI Description

The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on PATZ1

Similar Products

Product Notes

The PATZ1 patz1 (Catalog #AAA3204429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PATZ1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PATZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PATZ1 patz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MERVNDASCG PSGCYTYQVS RHSTEMLHNL NQQRKNGGRF CDVLLRVGDE. It is sometimes possible for the material contained within the vial of "PATZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.