Western Blot (WB)
(WB Suggested Anti-Masp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Rabbit Masp2 Polyclonal Antibody | anti-MASP2 antibody
Masp2 antibody - middle region
Gene Names
Masp2; MAp19; MASP-2
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Masp2; Polyclonal Antibody; Masp2 antibody - middle region; anti-MASP2 antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT
Sequence Length
685
Applicable Applications for anti-MASP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 79%; Horse: 77%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 92%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Masp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Masp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Masp2 Antibody Titration: 1 ug/mlSample Type: HeLa)
Western Blot (WB)
(WB Suggested Anti-Masp2 Antibody Titration: 1 ug/mlSample Type: HeLa)
Related Product Information for anti-MASP2 antibody
This is a rabbit polyclonal antibody against Masp2. It was validated on Western Blot
Target Description: Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase.
Target Description: Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase.
Product Categories/Family for anti-MASP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
mannan-binding lectin serine protease 2 isoform 1
NCBI Official Synonym Full Names
mannan-binding lectin serine peptidase 2
NCBI Official Symbol
Masp2
NCBI Official Synonym Symbols
MAp19; MASP-2
NCBI Protein Information
mannan-binding lectin serine protease 2
UniProt Protein Name
Mannan-binding lectin serine protease 2
Protein Family
UniProt Gene Name
Masp2
UniProt Synonym Gene Names
MASP-2
Uniprot Description
Serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase ().
Research Articles on MASP2
Similar Products
Product Notes
The MASP2 masp2 (Catalog #AAA3205922) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Masp2 antibody - middle region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Masp2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MASP2 masp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPQPYPKLSS CTYSIRLEDG FSVILDFVES FDVETHPEAQ CPYDSLKIQT. It is sometimes possible for the material contained within the vial of "Masp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
