Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MARCO Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateMARCO is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit anti-Human MARCO Polyclonal Antibody | anti-MARCO antibody

MARCO antibody - N-terminal region

Gene Names
MARCO; SR-A6; SCARA2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MARCO; Polyclonal Antibody; MARCO antibody - N-terminal region; anti-MARCO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
Sequence Length
520
Applicable Applications for anti-MARCO antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MARCO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MARCO Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateMARCO is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-MARCO Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateMARCO is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-MARCO antibody
This is a rabbit polyclonal antibody against MARCO. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec
Product Categories/Family for anti-MARCO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
macrophage receptor MARCO
NCBI Official Synonym Full Names
macrophage receptor with collagenous structure
NCBI Official Symbol
MARCO
NCBI Official Synonym Symbols
SR-A6; SCARA2
NCBI Protein Information
macrophage receptor MARCO
UniProt Protein Name
Macrophage receptor MARCO
Protein Family
UniProt Gene Name
MARCO
UniProt Synonym Gene Names
SCARA2

NCBI Description

The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger receptor cysteine-rich (SRCR) domain. In addition to short cytoplasmic and transmembrane domains, there is an extracellular spacer domain and a long, extracellular collagenous domain. The protein may form a trimeric molecule by the association of the collagenous domains of three identical polypeptide chains. [provided by RefSeq, Jul 2008]

Uniprot Description

MARCO: Pattern recognition receptor (PRR). Binds Gram-positive and Gram-negative bacteria.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: pattern recognition receptor activity; transmembrane receptor activity

Biological Process: cell surface receptor linked signal transduction; receptor-mediated endocytosis

Research Articles on MARCO

Similar Products

Product Notes

The MARCO marco (Catalog #AAA3205926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARCO antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MARCO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MARCO marco for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QARLRVLEMY FLNDTLAAED SPSFSLLQSA HPGEHLAQGA SRLQVLQAQL. It is sometimes possible for the material contained within the vial of "MARCO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.