Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAPK15 expression in transfected 293T cell line by MAPK15 polyclonal antibody. Lane 1: MAPK15 transfected lysate (30.58kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MAPK15 Polyclonal Antibody | anti-MAPK15 antibody

MAPK15 (ERK7, ERK8, Mitogen-activated Protein Kinase 15, MAP Kinase 15, MAPK 15, Extracellular Signal-regulated Kinase 7, ERK-7, Extracellular Signal-regulated Kinase 8, ERK-8)

Gene Names
MAPK15; ERK7; ERK8
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MAPK15; Polyclonal Antibody; MAPK15 (ERK7; ERK8; Mitogen-activated Protein Kinase 15; MAP Kinase 15; MAPK 15; Extracellular Signal-regulated Kinase 7; ERK-7; Extracellular Signal-regulated Kinase 8; ERK-8); Anti -MAPK15 (ERK7; anti-MAPK15 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAPK15.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSR*
Applicable Applications for anti-MAPK15 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MAPK15, aa1-278 (AAH28034)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAPK15 expression in transfected 293T cell line by MAPK15 polyclonal antibody. Lane 1: MAPK15 transfected lysate (30.58kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPK15 expression in transfected 293T cell line by MAPK15 polyclonal antibody. Lane 1: MAPK15 transfected lysate (30.58kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MAPK15 antibody
The ERKs are a subfamily of the MAPKs that have been implicated in cell growth and differentiation. Extracellular signal-regulated kinase 8 (Erk8) is a large MAP kinase whose activity is controlled by serum and the c-Src non-receptor tyrosine kinase. ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5 and can negatively regulate transcriptional co-activation of androgen receptor and GRalpha by Hic-5 in a kinase-independent manner, suggesting a broader role for ERK8 in the regulation of nuclear receptors beyond estrogen receptor alpha. Erk8 is a novel effector of RET/PTC3 and, therefore, RET biological functions.
Product Categories/Family for anti-MAPK15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,832 Da
NCBI Official Full Name
mitogen-activated protein kinase 15
NCBI Official Synonym Full Names
mitogen-activated protein kinase 15
NCBI Official Symbol
MAPK15
NCBI Official Synonym Symbols
ERK7; ERK8
NCBI Protein Information
mitogen-activated protein kinase 15; ERK-7; ERK-8; MAPK 15; MAP kinase 15; extracellular regulated kinase 8 delta; extracellular signal regulated kinase 8; extracellular signal-regulated kinase 7; extracellular signal-regulated kinase 8
UniProt Protein Name
Mitogen-activated protein kinase 15
UniProt Gene Name
MAPK15
UniProt Synonym Gene Names
ERK7; ERK8; MAP kinase 15; MAPK 15; ERK-7; ERK-8
UniProt Entry Name
MK15_HUMAN

Uniprot Description

ERK7: In vitro, phosphorylates MBP. Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, CMGC; Kinase, protein; EC 2.7.11.24; CMGC group; MAPK family; Erk7 subfamily

Chromosomal Location of Human Ortholog: -

Cellular Component: extracellular region; intracellular; nucleus

Molecular Function: MAP kinase activity; SH3 domain binding; ATP binding

Biological Process: positive regulation of protein ubiquitination; negative regulation of DNA replication; protein amino acid autophosphorylation; positive regulation of protein catabolic process; MAPKKK cascade; positive regulation of protein amino acid phosphorylation; negative regulation of transcription from RNA polymerase II promoter; response to estradiol stimulus

Research Articles on MAPK15

Similar Products

Product Notes

The MAPK15 mapk15 (Catalog #AAA643203) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPK15 (ERK7, ERK8, Mitogen-activated Protein Kinase 15, MAP Kinase 15, MAPK 15, Extracellular Signal-regulated Kinase 7, ERK-7, Extracellular Signal-regulated Kinase 8, ERK-8) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MAPK15 mapk15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCTVVDPRIV RRYLLRRQLG QGAYGIVWKA VDRRTGEVVA IKKIFDAFRD KTDAQRTFRE ITLLQEFGDH PNIISLLDVI RAENDRDIYL VFEFMGCPPS PPPPTAVRTL SADTDLNAVI RKGGLLQDVH VRSIFYQLLR ATRFLHSGHV VHRDQKPSNV LLDANCTVKL CDFGLARSLG DLPEGPEDQA VTEYVATRWY RAPEVLLSSH RYTLGVDMWS LGCILGEMLR GRPLFPGTST LHQLELILET IPPPSEEDLL ALGSGCRASV LHQLGSR*. It is sometimes possible for the material contained within the vial of "MAPK15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.