MAOA Polyclonal Antibody | anti-MAOA antibody

Anti-MAOA Antibody

Cat. Num. AAA177836

• Gene Names: MAOA; MAO-A
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: MAOA; Polyclonal Antibody; Anti-MAOA Antibody; Amine oxidase [flavin-containing] A; Amine oxidase [flavin containing] A; AOFA; AOFA_HUMAN; EC 1.4.3.4; MAO A; MAO-A; Maoa; Monoamine oxidase A; Monoamine oxidase type A antibody; monoamine oxidase A; anti-MAOA antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 527

• Applicable Applications for anti-MAOA antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MAOA Picoband antibody, MBS177836, Western blottingAll lanes: Anti MAOA (MBS177836) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD)

Immunohistochemistry (IHC)

(Anti- MAOA Picoband antibody, MBS177836,IHC(P)IHC(P): Mouse Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- MAOA Picoband antibody, MBS177836,IHC(P)IHC(P): Rat Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- MAOA Picoband antibody, MBS177836,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-MAOA antibody

Description: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: MAOA(Monoamine oxidase A), also known as AMINE OXIDASE (FLAVIN-CONTAINING) A, is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.

References

1. Breakefield, X. O., Ozelius, L., Hsu, Y. P., Powell, J., Utterback, M., Gusella, J. F., Bruns, G. A. Gene for A form of human monoamine oxidase (MAOA) maps to Xp21-Xp11. (Abstract) Am. J. Hum. Genet. 41: A209 only, 1987. 2. Brunner, H. G., Nelen, M., Breakefield, X. O., Ropers, H. H., van Oost, B. A. Abnormal behavior associated with a point mutation in the structural gene for monoamine oxidase A. Science 262: 578-580, 1993. 3. PDB 2BXS; De Colibus L, Li M, Binda C, Lustig A, Edmondson DE, Mattevi A (September 2005). "Three-dimensional structure of human monoamine oxidase A (MAO A): relation to the structures of rat MAO A and human MAO B".

NCBI and Uniprot Product Information

• NCBI GI #: 4557735
• NCBI GeneID: 4128
• NCBI Accession #: NP_000231.1
• NCBI GenBank Nucleotide #: NM_000240.3
• UniProt Accession #: P21397; Q16426; B4DF46
• Molecular Weight: 44,848 Da
• NCBI Official Full Name: amine oxidase
• NCBI Official Synonym Full Names: monoamine oxidase A
• NCBI Official Symbol: MAOA
• NCBI Official Synonym Symbols: MAO-A
• NCBI Protein Information: amine oxidase [flavin-containing] A
• UniProt Protein Name: Amine oxidase [flavin-containing] A
• Protein Family: Amine oxidase
• UniProt Gene Name: MAOA
• UniProt Synonym Gene Names: MAO-A
• UniProt Entry Name: AOFA_HUMAN

NCBI Description

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MAOA: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Defects in MAOA are the cause of Brunner syndrome (BRUNS). Brunner syndrome is a form of X-linked non- dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior. Belongs to the flavin monoamine oxidase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - histidine; EC 1.4.3.4; Oxidoreductase; Membrane protein, integral; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - tryptophan

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: integral to membrane; mitochondrial outer membrane; mitochondrion

Molecular Function: amine oxidase activity; FAD binding; serotonin binding

Biological Process: biogenic amine metabolic process; dopamine catabolic process; neurotransmitter catabolic process; neurotransmitter metabolic process; phenylethylamine metabolic process; serotonin metabolic process

Disease: Brunner Syndrome