Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MAGEL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Rabbit MAGEL2 Polyclonal Antibody | anti-MAGEL2 antibody

MAGEL2 antibody - N-terminal region

Gene Names
MAGEL2; PWLS; nM15; NDNL1; SHFYNG
Reactivity
Cow, Dog, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAGEL2; Polyclonal Antibody; MAGEL2 antibody - N-terminal region; anti-MAGEL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQGLFYRPQGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLP
Sequence Length
529
Applicable Applications for anti-MAGEL2 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 100%; Human: 100%; Pig: 88%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MAGEL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Western Blot (WB) (WB Suggested Anti-MAGEL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)
Related Product Information for anti-MAGEL2 antibody
This is a rabbit polyclonal antibody against MAGEL2. It was validated on Western Blot

Target Description: Prader-Willi syndrome (PWS) is caused by the loss of expression of imprinted genes in chromosome 15q11-q13 region. Affected individuals exhibit neonatal hypotonia, developmental delay, and childhood-onset obesity. Necdin (NDN), a gene involved in the terminal differentiation of neurons, localizes to this region of the genome and has been implicated as one of the genes responsible for the etiology of PWS. This gene is structurally similar to NDN, is also localized to the PWS chromosomal region, and is paternally imprinted, suggesting a possible role for it in PWS.
Product Categories/Family for anti-MAGEL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
MAGE-like protein 2
NCBI Official Synonym Full Names
MAGE family member L2
NCBI Official Symbol
MAGEL2
NCBI Official Synonym Symbols
PWLS; nM15; NDNL1; SHFYNG
NCBI Protein Information
MAGE-like protein 2
UniProt Protein Name
MAGE-like protein 2
Protein Family
UniProt Gene Name
MAGEL2
UniProt Synonym Gene Names
NDNL1
UniProt Entry Name
MAGL2_HUMAN

NCBI Description

Prader-Willi syndrome (PWS) is caused by the loss of expression of imprinted genes in chromosome 15q11-q13 region. Affected individuals exhibit neonatal hypotonia, developmental delay, and childhood-onset obesity. Necdin (NDN), a gene involved in the terminal differentiation of neurons, localizes to this region of the genome and has been implicated as one of the genes responsible for the etiology of PWS. This gene is structurally similar to NDN, is also localized to the PWS chromosomal region, and is paternally imprinted, suggesting a possible role for it in PWS. [provided by RefSeq, Oct 2010]

Uniprot Description

MAGE-L2: May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. Interacts with TRIM27

Chromosomal Location of Human Ortholog: 15q11.2

Cellular Component: retromer complex; early endosome; nucleus; endosome

Molecular Function: protein binding; ubiquitin-protein ligase activity

Biological Process: transcription, DNA-dependent; rhythmic process; negative regulation of transcription, DNA-dependent; regulation of circadian rhythm; retrograde transport, endosome to Golgi

Disease: Prader-willi Syndrome; Prader-willi-like Syndrome

Research Articles on MAGEL2

Similar Products

Product Notes

The MAGEL2 magel2 (Catalog #AAA3214557) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEL2 antibody - N-terminal region reacts with Cow, Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAGEL2 magel2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQGLFYRPQG SSKERRTSSK ERRAPSKDRM IFAATFCAPK AVSAARAHLP. It is sometimes possible for the material contained within the vial of "MAGEL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.