Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MAGEC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMAGEC2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit anti-Human MAGEC2 Polyclonal Antibody | anti-MAGEC2 antibody

MAGEC2 antibody - N-terminal region

Gene Names
MAGEC2; CT10; HCA587; MAGEE1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAGEC2; Polyclonal Antibody; MAGEC2 antibody - N-terminal region; anti-MAGEC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF
Sequence Length
373
Applicable Applications for anti-MAGEC2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MAGEC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMAGEC2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-MAGEC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMAGEC2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-MAGEC2 antibody
This is a rabbit polyclonal antibody against MAGEC2. It was validated on Western Blot

Target Description: This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27.
Product Categories/Family for anti-MAGEC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
melanoma-associated antigen C2
NCBI Official Synonym Full Names
MAGE family member C2
NCBI Official Symbol
MAGEC2
NCBI Official Synonym Symbols
CT10; HCA587; MAGEE1
NCBI Protein Information
melanoma-associated antigen C2
UniProt Protein Name
Melanoma-associated antigen C2
UniProt Gene Name
MAGEC2
UniProt Synonym Gene Names
HCA587; MAGEE1; CT10
UniProt Entry Name
MAGC2_HUMAN

NCBI Description

This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefSeq, Oct 2009]

Uniprot Description

MAGE-C2: Proposed to enhance ubiquitin ligase activity of RING- type zinc finger-containing E3 ubiquitin-protein ligases. In vitro enhances ubiquitin ligase activity of TRIM28 and stimulates p53/TP53 ubiquitination in presence of Ubl-conjugating enzyme UBE2H leading to p53/TP53 degradation. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzymes (E2) at the E3:substrate complex.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq27

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: cellular protein catabolic process; positive regulation of ubiquitin-protein ligase activity

Research Articles on MAGEC2

Similar Products

Product Notes

The MAGEC2 magec2 (Catalog #AAA3214556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGEC2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAGEC2 magec2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCCSSFSWSS FSEESSSQKG EDTGTCQGLP DSESSFTYTL DEKVAELVEF. It is sometimes possible for the material contained within the vial of "MAGEC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.