Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MAEA AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Rabbit MAEA Polyclonal Antibody | anti-MAEA antibody

MAEA antibody - N-terminal region

Gene Names
MAEA; EMP; EMLP; GID9; PIG5; HLC-10; P44EMLP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAEA; Polyclonal Antibody; MAEA antibody - N-terminal region; anti-MAEA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVL
Sequence Length
355
Applicable Applications for anti-MAEA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MAEA AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-MAEA AntibodyTitration: 1.0 ug/mlPositive Control: NCI-H226 Whole Cell)
Related Product Information for anti-MAEA antibody
This is a rabbit polyclonal antibody against MAEA. It was validated on Western Blot

Target Description: This gene product mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturation and enucleation of erythroblasts, presumably by suppressing apoptosis. This protein is an integral membrane protein with the N-terminus on the extracellular side and the C-terminus on the cytoplasmic side of the cell. Two immunologically related isoforms of erythroblast macrophage protein with apparent molecular weights of 33 kD and 36 kD were detected in macrophage membranes; this gene encodes the larger isoform. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Product Categories/Family for anti-MAEA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
E3 ubiquitin-protein transferase MAEA isoform 1
NCBI Official Synonym Full Names
macrophage erythroblast attacher
NCBI Official Symbol
MAEA
NCBI Official Synonym Symbols
EMP; EMLP; GID9; PIG5; HLC-10; P44EMLP
NCBI Protein Information
E3 ubiquitin-protein transferase MAEA; macrophage erythroblast attacher
UniProt Protein Name
Macrophage erythroblast attacher
UniProt Gene Name
MAEA
UniProt Synonym Gene Names
EMP; HLC-10
UniProt Entry Name
MAEA_HUMAN

NCBI Description

This gene encodes a protein that mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturation and enucleation of erythroblasts, presumably by suppressing apoptosis. The encoded protein is an integral membrane protein with the N-terminus on the extracellular side and the C-terminus on the cytoplasmic side of the cell. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

MAEA: Plays a role in erythroblast enucleation and in the development of the mature macrophages. Mediates the attachment of erythroid cell to mature macrophages, in correlation with the presence of MAEA at cell surface of mature macrophages; This MAEA- mediated contact inhibits erythroid cells apoptosis. Participates to erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion; Cell development/differentiation; Actin-binding

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: nucleoplasm; cytoskeleton; nuclear matrix; integral to plasma membrane; cytoplasm; contractile ring; spindle; nucleus

Molecular Function: actin binding

Biological Process: negative regulation of myeloid cell apoptosis; erythrocyte maturation; cell division; regulation of mitotic cell cycle; enucleate erythrocyte development; cytoskeleton organization and biogenesis; cell adhesion; cell cycle

Research Articles on MAEA

Similar Products

Product Notes

The MAEA maea (Catalog #AAA3216440) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAEA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAEA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAEA maea for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFRAAQKNID RETSHVTMVV AELEKTLSGC PAVDSVVSLL DGVVEKLSVL. It is sometimes possible for the material contained within the vial of "MAEA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.