Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAD2L1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAD2L1 Polyclonal Antibody | anti-MAD2L1 antibody

MAD2L1 Antibody - middle region

Gene Names
MAD2L1; MAD2; HSMAD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAD2L1; Polyclonal Antibody; MAD2L1 Antibody - middle region; anti-MAD2L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKV
Sequence Length
205
Applicable Applications for anti-MAD2L1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAD2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAD2L1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAD2L1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAD2L1 antibody
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.
Product Categories/Family for anti-MAD2L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
mitotic spindle assembly checkpoint protein MAD2A
NCBI Official Synonym Full Names
mitotic arrest deficient 2 like 1
NCBI Official Symbol
MAD2L1
NCBI Official Synonym Symbols
MAD2; HSMAD2
NCBI Protein Information
mitotic spindle assembly checkpoint protein MAD2A
UniProt Protein Name
Mitotic spindle assembly checkpoint protein MAD2A
Protein Family
UniProt Gene Name
MAD2L1
UniProt Synonym Gene Names
MAD2; HsMAD2
UniProt Entry Name
MD2L1_HUMAN

NCBI Description

MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008]

Uniprot Description

MAD2L1: required for the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. Inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate. Interacts with Cdc20, MAD2L1BP and with ADAM17/TACE

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 4q27

Cellular Component: kinetochore; spindle pole; perinuclear region of cytoplasm; nuclear pore; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity

Biological Process: negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; mitotic sister chromatid segregation; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle checkpoint; mitotic cell cycle spindle assembly checkpoint; negative regulation of mitotic cell cycle; mitotic cell cycle; negative regulation of protein catabolic process; negative regulation of apoptosis

Research Articles on MAD2L1

Similar Products

Product Notes

The MAD2L1 mad2l1 (Catalog #AAA3221529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAD2L1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAD2L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAD2L1 mad2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLEVSCSFDL LIYTDKDLVV PEKWEESGPQ FITNSEEVRL RSFTTTIHKV. It is sometimes possible for the material contained within the vial of "MAD2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.