SDS-PAGE
Mitochondrial import receptor subunit TOM40 homolog (TOMM40) Recombinant Protein | TOMM40 recombinant protein
Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40)
Gene Names
TOMM40; TOM40; PEREC1; C19orf1; PER-EC1; D19S1177E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import receptor subunit TOM40 homolog (TOMM40); Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40); Mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; Translocase of outer membrane 40 kDa subunit homolog; p38.5; TOMM40 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-361aa; Full Length
Sequence
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Sequence Length
361
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for TOMM40 recombinant protein
Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Product Categories/Family for TOMM40 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64.9 kDa
NCBI Official Full Name
mitochondrial import receptor subunit TOM40 homolog
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 40 homolog (yeast)
NCBI Official Symbol
TOMM40
NCBI Official Synonym Symbols
TOM40; PEREC1; C19orf1; PER-EC1; D19S1177E
NCBI Protein Information
mitochondrial import receptor subunit TOM40 homolog; p38.5; protein Haymaker; mitochondrial outer membrane protein; translocase of outer membrane 40 kDa subunit homolog
UniProt Protein Name
Mitochondrial import receptor subunit TOM40 homolog
Protein Family
UniProt Gene Name
TOMM40
UniProt Synonym Gene Names
C19orf1; PEREC1; TOM40
UniProt Entry Name
TOM40_HUMAN
NCBI Description
TOMM40 is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for protein import into mitochondria (Humphries et al., 2005 [PubMed 15644312]).[supplied by OMIM, May 2008]
Uniprot Description
TOMM40: Channel-forming protein essential for import of protein precursors into mitochondria. Belongs to the Tom40 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Mitochondrial
Chromosomal Location of Human Ortholog: 19q13
Cellular Component: nucleoplasm; pore complex; mitochondrial outer membrane translocase complex; mitochondrion; cytoplasm; integral to membrane; integral to mitochondrial outer membrane
Molecular Function: protein transmembrane transporter activity; porin activity
Biological Process: cellular protein metabolic process; ion transport; protein targeting to mitochondrion
Research Articles on TOMM40
Similar Products
Product Notes
The TOMM40 tomm40 (Catalog #AAA1006142) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361aa; Full Length. The amino acid sequence is listed below: MGNVLAASSP PAGPPPPPAP ALVGLPPPPP SPPGFTLPPL GGSLGAGTST SRSSERTPGA ATASASGAAE DGACGCLPNP GTFEECHRKC KELFPIQMEG VKLTVNKGLS NHFQVNHTVA LSTIGESNYH FGVTYVGTKQ LSPTEAFPVL VGDMDNSGSL NAQVIHQLGP GLRSKMAIQT QQSKFVNWQV DGEYRGSDFT AAVTLGNPDV LVGSGILVAH YLQSITPCLA LGGELVYHRR PGEEGTVMSL AGKYTLNNWL ATVTLGQAGM HATYYHKASD QLQVGVEFEA STRMQDTSVS FGYQLDLPKA NLLFKGSVDS NWIVGATLEK KLPPLPLTLA LGAFLNHRKN KFQCGFGLTI G. It is sometimes possible for the material contained within the vial of "Mitochondrial import receptor subunit TOM40 homolog (TOMM40), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
