Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAD1L1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MAD1L1 Polyclonal Antibody | anti-MAD1L1 antibody

MAD1L1 Antibody - N-terminal region

Gene Names
MAD1L1; MAD1; PIG9; TP53I9; TXBP181
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAD1L1; Polyclonal Antibody; MAD1L1 Antibody - N-terminal region; anti-MAD1L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQ
Sequence Length
718
Applicable Applications for anti-MAD1L1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAD1L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAD1L1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAD1L1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAD1L1 antibody
MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MAD1L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78 kDa
NCBI Official Full Name
mitotic spindle assembly checkpoint protein MAD1 isoform a
NCBI Official Synonym Full Names
mitotic arrest deficient 1 like 1
NCBI Official Symbol
MAD1L1
NCBI Official Synonym Symbols
MAD1; PIG9; TP53I9; TXBP181
NCBI Protein Information
mitotic spindle assembly checkpoint protein MAD1
UniProt Protein Name
Mitotic spindle assembly checkpoint protein MAD1
UniProt Gene Name
MAD1L1
UniProt Synonym Gene Names
MAD1; TXBP181; MAD1-like protein 1; HsMAD1; hMAD1
UniProt Entry Name
MD1L1_HUMAN

NCBI Description

MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

MAD1L1: a component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Has a role in the correct positioning of the septum. Required for anchoring MAD2L1 to the nuclear periphery. Expressed weakly at G0/G1 and highly at late S and G2/M phase. Induced by p53. Becomes hyperphosphorylated in late S through M phases or after mitotic spindle damage. Two alternatively spliced isoforms have been described. Defects in MAD1L1 are involved in the development and/or progression of various types of cancer.

Protein type: Cytoskeletal; Cell cycle regulation

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: kinetochore; centrosome; cytoplasm; nuclear pore; spindle; nucleus; cytosol; actin cytoskeleton

Molecular Function: protein binding

Biological Process: mitosis; cell division; mitotic cell cycle checkpoint; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle

Disease: Prostate Cancer

Research Articles on MAD1L1

Similar Products

Product Notes

The MAD1L1 mad1l1 (Catalog #AAA3221662) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAD1L1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAD1L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAD1L1 mad1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLIQVEREKM QMELSHKRAR VELERAASTS ARNYEREVDR NQELLTRIRQ. It is sometimes possible for the material contained within the vial of "MAD1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.