Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LYZL6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit LYZL6 Polyclonal Antibody | anti-LYZL6 antibody

LYZL6 antibody - N-terminal region

Gene Names
LYZL6; LYC1; LYZB; UNQ754; PRO1485; TKAL754; HEL-S-6a
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYZL6; Polyclonal Antibody; LYZL6 antibody - N-terminal region; anti-LYZL6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL
Sequence Length
148
Applicable Applications for anti-LYZL6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 75%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LYZL6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LYZL6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-LYZL6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-LYZL6 antibody
This is a rabbit polyclonal antibody against LYZL6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.
Product Categories/Family for anti-LYZL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
lysozyme-like protein 6
NCBI Official Synonym Full Names
lysozyme like 6
NCBI Official Symbol
LYZL6
NCBI Official Synonym Symbols
LYC1; LYZB; UNQ754; PRO1485; TKAL754; HEL-S-6a
NCBI Protein Information
lysozyme-like protein 6
UniProt Protein Name
Lysozyme-like protein 6
Protein Family
UniProt Gene Name
LYZL6
UniProt Synonym Gene Names
LYC1
UniProt Entry Name
LYZL6_HUMAN

NCBI Description

This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

LYZL6: a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]

Protein type: Hydrolase; EC 3.2.1.17; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: extracellular region

Molecular Function: lysozyme activity

Biological Process: metabolic process

Research Articles on LYZL6

Similar Products

Product Notes

The LYZL6 lyzl6 (Catalog #AAA3211487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYZL6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LYZL6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYZL6 lyzl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTKALLIYLV SSFLALNQAS LISRCDLAQV LQLEDLDGFE GYSLSDWLCL. It is sometimes possible for the material contained within the vial of "LYZL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.