Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.)

Rabbit anti-Human Lysozyme-like 6 Polyclonal Antibody | anti-LYZL6 antibody

Lysozyme-like 6 (Lysozyme Homolog, 1700023H08Rik, LOC57151, LYC1, LYZL6, PRO1485, RGD1306968, TKAL754)

Gene Names
LYZL6; LYC1; UNQ754; PRO1485; TKAL754
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity Purified
Purified by immunoaffinity chromatography.
Synonyms
Lysozyme-like 6; Polyclonal Antibody; Lysozyme-like 6 (Lysozyme Homolog; 1700023H08Rik; LOC57151; LYC1; LYZL6; PRO1485; RGD1306968; TKAL754); Anti -Lysozyme-like 6 (Lysozyme Homolog; anti-LYZL6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human Lysozyme-like 6.
Purity/Purification
Affinity Purified
Purified by immunoaffinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2, 40% glycerol, 0.02% sodium azide.
Applicable Applications for anti-LYZL6 antibody
Immunohistochemistry (IHC)
Application Notes
Suitable for use in Immunohistochemistry.
Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferus ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.
Immunogen
Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
Preparation and Storage
May be stored at 4 degree C for short-term only. For long-term storage, store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Immunohistochemistry (IHC)

(Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.)

Immunohistochemistry (IHC) (Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.)
Related Product Information for anti-LYZL6 antibody
LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.
Product Categories/Family for anti-LYZL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,956 Da
NCBI Official Full Name
lysozyme-like protein 6
NCBI Official Synonym Full Names
lysozyme-like 6
NCBI Official Symbol
LYZL6
NCBI Official Synonym Symbols
LYC1; UNQ754; PRO1485; TKAL754
NCBI Protein Information
lysozyme-like protein 6; lysozyme homolog; OTTHUMP00000163949; OTTHUMP00000163950
UniProt Protein Name
Lysozyme-like protein 6
Protein Family
UniProt Gene Name
LYZL6
UniProt Synonym Gene Names
LYC1
UniProt Entry Name
LYZL6_HUMAN

NCBI Description

This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq]

Uniprot Description

LYZL6: a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]

Protein type: Secreted, signal peptide; Secreted; EC 3.2.1.17; Hydrolase

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: extracellular region

Molecular Function: lysozyme activity

Biological Process: metabolic process

Similar Products

Product Notes

The LYZL6 lyzl6 (Catalog #AAA620390) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Lysozyme-like 6 (Lysozyme Homolog, 1700023H08Rik, LOC57151, LYC1, LYZL6, PRO1485, RGD1306968, TKAL754) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Lysozyme-like 6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Suitable for use in Immunohistochemistry. Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferus ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining. Researchers should empirically determine the suitability of the LYZL6 lyzl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lysozyme-like 6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.