Western Blot (WB)
(Western Blot analysis of LY6G5B expression in transfected 293T cell line by LY6G5B polyclonal antibody. Lane 1: LY6G5B transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human LY6G5B Polyclonal Antibody | anti-LY6G5B antibody
LY6G5B (Lymphocyte Antigen 6 Complex Locus Protein G5b, C6orf19, G5B)
Gene Names
LY6G5B; G5b; C6orf19
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LY6G5B; Polyclonal Antibody; LY6G5B (Lymphocyte Antigen 6 Complex Locus Protein G5b; C6orf19; G5B); Anti -LY6G5B (Lymphocyte Antigen 6 Complex Locus Protein G5b; anti-LY6G5B antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LY6G5B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
Applicable Applications for anti-LY6G5B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LY6G5B, aa1-201 (NP_067044.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of LY6G5B expression in transfected 293T cell line by LY6G5B polyclonal antibody. Lane 1: LY6G5B transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LY6G5B expression in transfected 293T cell line by LY6G5B polyclonal antibody. Lane 1: LY6G5B transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-LY6G5B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,572 Da
NCBI Official Full Name
lymphocyte antigen 6 complex locus protein G5b
NCBI Official Synonym Full Names
lymphocyte antigen 6 complex, locus G5B
NCBI Official Symbol
LY6G5B
NCBI Official Synonym Symbols
G5b; C6orf19
NCBI Protein Information
lymphocyte antigen 6 complex locus protein G5b; lymphocyte antigen-6 G5B splicing isoform 690
UniProt Protein Name
Lymphocyte antigen 6 complex locus protein G5b
Protein Family
UniProt Gene Name
LY6G5B
UniProt Synonym Gene Names
C6orf19; G5B
UniProt Entry Name
LY65B_HUMAN
NCBI Description
LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM, Mar 2008]
Uniprot Description
LY6G5B: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 6p21.3
Cellular Component: extracellular region
Research Articles on LY6G5B
Similar Products
Product Notes
The LY6G5B ly6g5b (Catalog #AAA6001692) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LY6G5B (Lymphocyte Antigen 6 Complex Locus Protein G5b, C6orf19, G5B) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LY6G5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LY6G5B ly6g5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKVHMLVGVL VMVGFTVGKV PVPDIRTCHF CLVEDPSVGC ISGSEKCTIS SSSLCMVITI YYDVKVRFIV RGCGQYISYR CQEKRNTYFA EYWYQAQCCQ YDYCNSWSSP QLQSSLPEPH DRPLALPLSD SQIQWFYQAL NLSLPLPNFH AGTEPDGLDP MVTLSLNLGL SFAELRRMYL FLNSSGLLVL PQAGLLTPHP S. It is sometimes possible for the material contained within the vial of "LY6G5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
