Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FKBP11 polyclonal antibody. Western Blot analysis of FKBP11 expression in human pancreas.)

Mouse anti-Human FKBP11 Polyclonal Antibody

FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FKBP11; Polyclonal Antibody; FKBP11 (FK506-binding Protein 11; Peptidyl-prolyl Cis-trans Isomerase FKBP11; PPIase FKBP11; Rotamase; 19kD FK506-binding Protein; 19kD FKBP; FKBP-19; UNQ336/PRO535; FKBP19; FKBP-11; MGC54182); Anti -FKBP11 (FK506-binding Protein 11; anti-FKBP11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FKBP11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Applicable Applications for anti-FKBP11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FKBP11, aa1-201 (NP_057678.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FKBP11 polyclonal antibody. Western Blot analysis of FKBP11 expression in human pancreas.)

Western Blot (WB) (FKBP11 polyclonal antibody. Western Blot analysis of FKBP11 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of FKBP11 expression in transfected 293T cell line by FKBP11 polyclonal antibody. Lane 1: FKBP11 transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FKBP11 expression in transfected 293T cell line by FKBP11 polyclonal antibody. Lane 1: FKBP11 transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FKBP11 antibody
FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.
Product Categories/Family for anti-FKBP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
FKBP11

Uniprot Description

FKBP11: PPIases accelerate the folding of proteins during protein synthesis. Belongs to the FKBP-type PPIase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.2.1.8; Membrane protein, integral; Isomerase

Chromosomal Location of Human Ortholog: 12q13.12

Cellular Component: endoplasmic reticulum membrane; membrane; integral to membrane

Molecular Function: FK506 binding; peptidyl-prolyl cis-trans isomerase activity

Biological Process: protein peptidyl-prolyl isomerization

Similar Products

Product Notes

The FKBP11 (Catalog #AAA6006605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FKBP11 (FK506-binding Protein 11, Peptidyl-prolyl Cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11, MGC54182) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FKBP11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTLRPSLLPL HLLLLLLLSA AVCRAEAGLE TESPVRTLQV ETLVEPPEPC AEPAAFGDTL HIHYTGSLVD GRIIDTSLTR DPLVIELGQK QVIPGLEQSL LDMCVGEKRR AIIPSHLAYG KRGFPPSVPA DAVVQYDVEL IALIRANYWL KLVKGILPLV GMAMVPALLG LIGYHLYRKA NRPKVSKKKL KEEKRNKSKK K. It is sometimes possible for the material contained within the vial of "FKBP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.