Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NOL6 expression in transfected 293T cell line by NOL6 polyclonal antibody. Lane 1: NOL6 transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human NOL6 Polyclonal Antibody | anti-NOL6 antibody

NOL6 (Nucleolar Protein 6, Nucleolar RNA-associated Protein, Nrap, UTP22, bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838)

Gene Names
NOL6; NRAP; UTP22; bA311H10.1
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NOL6; Polyclonal Antibody; NOL6 (Nucleolar Protein 6; Nucleolar RNA-associated Protein; Nrap; UTP22; bA311H10.1; FLJ21959; MGC14896; MGC14921; MGC20838); Anti -NOL6 (Nucleolar Protein 6; anti-NOL6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NOL6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Applicable Applications for anti-NOL6 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human NOL6, aa1-201 (AAH08298).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NOL6 expression in transfected 293T cell line by NOL6 polyclonal antibody. Lane 1: NOL6 transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NOL6 expression in transfected 293T cell line by NOL6 polyclonal antibody. Lane 1: NOL6 transfected lysate (22.11kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to NOL6 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to NOL6 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-NOL6 antibody
Probably associated with rRNA.
Product Categories/Family for anti-NOL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
127,593 Da
NCBI Official Full Name
NOL6 protein, partial
NCBI Official Synonym Full Names
nucleolar protein 6 (RNA-associated)
NCBI Official Symbol
NOL6
NCBI Official Synonym Symbols
NRAP; UTP22; bA311H10.1
NCBI Protein Information
nucleolar protein 6; nucleolar RNA-associated protein; nucleolar protein family 6 (RNA-associated)
UniProt Protein Name
Nucleolar protein 6
Protein Family
UniProt Gene Name
NOL6
UniProt Synonym Gene Names
Nrap
UniProt Entry Name
NOL6_HUMAN

NCBI Description

The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

NOL6: The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: small subunit processome; condensed nuclear chromosome; mitochondrion; nucleolus; nucleus

Biological Process: tRNA export from nucleus; rRNA processing

Similar Products

Product Notes

The NOL6 nol6 (Catalog #AAA641778) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOL6 (Nucleolar Protein 6, Nucleolar RNA-associated Protein, Nrap, UTP22, bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOL6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the NOL6 nol6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVIVTPQDRK NSVWTQDGPS AQILQQLVVL AAEALPMLEK QLMDPRGPGD IRTVFRPPLD IYDVLIRLSP RHIPRHRQAV DSPAASFCRG LLSQPGPSSL MPVLGYDPPQ LYLTQLREAF GDLALFFYDQ HGGEVIGVLW KPTSFQPQPF KASSTKGRMV MSRGGELVMV PNVEAILEDF AVLGEGLVQT VEARSERWTV. It is sometimes possible for the material contained within the vial of "NOL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.