Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LTBRSample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit LTBR Polyclonal Antibody | anti-LTBR antibody

LTBR Antibody - N-terminal region

Gene Names
LTBR; TNFCR; TNFR3; D12S370; TNFR-RP; TNFRSF3; TNFR2-RP; LT-BETA-R; TNF-R-III
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LTBR; Polyclonal Antibody; LTBR Antibody - N-terminal region; anti-LTBR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY
Sequence Length
435
Applicable Applications for anti-LTBR antibody
Western Blot (WB)
Homology
Cow: 90%; Dog: 77%; Goat: 90%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Rabbit: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LTBR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LTBRSample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LTBRSample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LTBR antibody
This is a rabbit polyclonal antibody against LTBR. It was validated on Western Blot

Target Description: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 3 isoform 1
NCBI Official Synonym Full Names
lymphotoxin beta receptor
NCBI Official Symbol
LTBR
NCBI Official Synonym Symbols
TNFCR; TNFR3; D12S370; TNFR-RP; TNFRSF3; TNFR2-RP; LT-BETA-R; TNF-R-III
NCBI Protein Information
tumor necrosis factor receptor superfamily member 3
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 3
UniProt Gene Name
LTBR
UniProt Synonym Gene Names
D12S370; TNFCR; TNFR3; TNFRSF3; TNF-RIII; TNFR-III
UniProt Entry Name
TNR3_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2012]

Uniprot Description

LTBR: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: identical protein binding; protein binding; tumor necrosis factor receptor activity; ubiquitin protein ligase binding

Biological Process: immune response; inflammatory response; multicellular organismal development; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of JNK cascade; regulation of cell proliferation; response to lipopolysaccharide; signal transduction; tumor necrosis factor-mediated signaling pathway

Research Articles on LTBR

Similar Products

Product Notes

The LTBR ltbr (Catalog #AAA3200240) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LTBR Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LTBR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LTBR ltbr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLGLFGLLAA SQPQAVPPYA SENQTCRDQE KEYYEPQHRI CCSRCPPGTY. It is sometimes possible for the material contained within the vial of "LTBR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.