Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LSAMP expression in transfected 293T cell line by LSAMP polyclonal antibody. Lane 1: LSAMP transfected lysate (37.29kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human LSAMP Polyclonal Antibody | anti-LSAMP antibody

LSAMP (Limbic System-associated Membrane Protein, IgLON Family Member 3, IGLON3, LAMP)

Gene Names
LSAMP; LAMP; IGLON3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LSAMP; Polyclonal Antibody; LSAMP (Limbic System-associated Membrane Protein; IgLON Family Member 3; IGLON3; LAMP); Anti -LSAMP (Limbic System-associated Membrane Protein; anti-LSAMP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LSAMP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC
Applicable Applications for anti-LSAMP antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LSAMP, aa29-338 (AAH33803).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LSAMP expression in transfected 293T cell line by LSAMP polyclonal antibody. Lane 1: LSAMP transfected lysate (37.29kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LSAMP expression in transfected 293T cell line by LSAMP polyclonal antibody. Lane 1: LSAMP transfected lysate (37.29kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LSAMP antibody
Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.
Product Categories/Family for anti-LSAMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,393 Da
NCBI Official Full Name
limbic system-associated membrane protein preproprotein
NCBI Official Synonym Full Names
limbic system-associated membrane protein
NCBI Official Symbol
LSAMP
NCBI Official Synonym Symbols
LAMP; IGLON3
NCBI Protein Information
limbic system-associated membrane protein; IgLON family member 3
UniProt Protein Name
Limbic system-associated membrane protein
UniProt Gene Name
LSAMP
UniProt Synonym Gene Names
IGLON3; LAMP; LSAMP
UniProt Entry Name
LSAMP_HUMAN

NCBI Description

The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. [provided by RefSeq, Jul 2008]

Uniprot Description

LSAMP: Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection. Belongs to the immunoglobulin superfamily. IgLON family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 3q13.2-q21

Cellular Component: neuron projection; cell surface; cell soma; plasma membrane; intercellular junction

Molecular Function: protein binding

Biological Process: nervous system development; cell-cell adhesion; regulation of neurogenesis

Research Articles on LSAMP

Similar Products

Product Notes

The LSAMP lsamp (Catalog #AAA6000989) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LSAMP (Limbic System-associated Membrane Protein, IgLON Family Member 3, IGLON3, LAMP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSAMP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LSAMP lsamp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VRSVDFNRGT DNITVRQGDT AILRCVVEDK NSKVAWLNRS GIIFAGHDKW SLDPRVELEK RHSLEYSLRI QKVDVYDEGS YTCSVQTQHE PKTSQVYLIV QVPPKISNIS SDVTVNEGSN VTLVCMANGR PEPVITWRHL TPTGREFEGE EEYLEILGIT REQSGKYECK AANEVSSADV KQVKVTVNYP PTITESKSNE ATTGRQASLK CEASAVPAPD FEWYRDDTRI NSANGLEIKS TEGQSSLTVT NVTEEHYGNY TCVAANKLGV TNASLVLFRP GSVRGINGSI SLAVPLWLLA ASLLCLLSKC. It is sometimes possible for the material contained within the vial of "LSAMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.