Mouse anti-Human LRRFIP1 Polyclonal Antibody | anti-LRRFIP1 antibody

LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP)

Cat. Num. AAA648335

• Gene Names: LRRFIP1; GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: LRRFIP1; Polyclonal Antibody; LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1; LRR FLII-interacting Protein 1; GC-binding Factor 2; TAR RNA-interacting Protein; GCF2; TRIP); Anti -LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1; anti-LRRFIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LRRFIP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ

• Applicable Applications for anti-LRRFIP1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human LRRFIP1, aa1-105 (AAH10662.1)
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LRRFIP1 expression in transfected 293T cell line by LRRFIP1 polyclonal antibody. Lane 1: LRRFIP1 transfected lysate (12.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LRRFIP1 antibody

Leucine-rich repeat FLI-I interacting protein 1 (LRRFIP1/FLAP-1) is a MyD88-interacting signal protein which mediates either induction or repression of TLR signaling. Flap-1 directly interacts with beta-catenin and activates beta-catenin-dependent transcription activity. Flap-1 or LRRFIP1 was also shown to bind the TNF- -308 promoter polymorphism site, suggesting its possible role in the regulation of TNF- production. FLAP-1 along with LRRFIP2 and FLIIH serve as a balance in coordinating inflammatory response after infection, and may act as a novel target in the control of agonist-induced TLR-mediated inflammatory and autoimmune diseases.

Product Categories/Family for anti-LRRFIP1 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 212276104
• NCBI GeneID: 9208
• NCBI Accession #: NP_001131025.1
• NCBI GenBank Nucleotide #: NM_001137553.1
• UniProt Accession #: Q32MZ4; O75766; O75799; Q32MZ5; Q53T49; Q6PKG2; Q9Y607; E9PGZ2
• Molecular Weight: 89,253 Da
• NCBI Official Full Name: leucine-rich repeat flightless-interacting protein 1 isoform 5
• NCBI Official Synonym Full Names: leucine rich repeat (in FLII) interacting protein 1
• NCBI Official Symbol: LRRFIP1
• NCBI Official Synonym Symbols: GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
• NCBI Protein Information: leucine-rich repeat flightless-interacting protein 1; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1
• UniProt Protein Name: Leucine-rich repeat flightless-interacting protein 1
• Protein Family: Leucine-rich repeat flightless-interacting protein
• UniProt Gene Name: LRRFIP1
• UniProt Synonym Gene Names: GCF2; TRIP; LRR FLII-interacting protein 1
• UniProt Entry Name: LRRF1_HUMAN

Uniprot Description

Function: Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA. Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding. Ref.1 Ref.6 Ref.7 Ref.8 Ref.13

Subunit structure: Homodimer. May also form higher oligomers. Interacts with FLII. Interacts with MYD88. Competes with FLII for MyD88-binding, even in the absence of LPS. Ref.2 Ref.13 Ref.18

Subcellular location: Nucleus. Cytoplasm Ref.2 Ref.7.

Tissue specificity: Ubiquitously expressed. Ref.1 Ref.2

Developmental stage: Widely expressed in fetal tissues. Ref.2

Domain: The DNA-binding domain is intrinsically unstructured. Ref.18The coiled coil mediates dimerization. Ref.18

Sequence similarities: Belongs to the LRRFIP family.

Sequence caution: The sequence AAH01385.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.The sequence AAY14672.1 differs from that shown. Reason: Erroneous gene model prediction.