Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LRRFIP1 rabbit polyclonal antibody. Western Blot analysis of LRRFIP1 expression in NIH/3T3)

Rabbit anti-Human, Mouse LRRFIP1 Polyclonal Antibody | anti-LRRFIP1 antibody

LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) APC

Gene Names
LRRFIP1; GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LRRFIP1; Polyclonal Antibody; LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1; LRR FLII-interacting Protein 1; GC-binding Factor 2; TAR RNA-interacting Protein; GCF2; TRIP) APC; anti-LRRFIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LRRFIP1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1726
Applicable Applications for anti-LRRFIP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LRRFIP1, aa1-105 (AAH10662.1)
Immunogen Sequence
MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LRRFIP1 rabbit polyclonal antibody. Western Blot analysis of LRRFIP1 expression in NIH/3T3)

Western Blot (WB) (LRRFIP1 rabbit polyclonal antibody. Western Blot analysis of LRRFIP1 expression in NIH/3T3)

Western Blot (WB)

(Western Blot analysis of LRRFIP1 expression in transfected 293T cell line by LRRFIP1 polyclonal antibody. Lane 1: LRRFIP1 transfected lysate (12.2kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of LRRFIP1 expression in transfected 293T cell line by LRRFIP1 polyclonal antibody. Lane 1: LRRFIP1 transfected lysate (12.2kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-LRRFIP1 antibody
Leucine-rich repeat FLI-I interacting protein 1 (LRRFIP1/FLAP-1) is a MyD88-interacting signal protein which mediates either induction or repression of TLR signaling. Flap-1 directly interacts with beta-catenin and activates beta-catenin-dependent transcription activity. Flap-1 or LRRFIP1 was also shown to bind the TNF--308 promoter polymorphism site, suggesting its possible role in the regulation of TNF-production. FLAP-1 along with LRRFIP2 and FLIIH serve as a balance in coordinating inflammatory response after infection, and may act as a novel target in the control of agonist-induced TLR-mediated inflammatory and autoimmune diseases.
Product Categories/Family for anti-LRRFIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens leucine rich repeat (in FLII) interacting protein 1, mRNA
NCBI Official Synonym Full Names
LRR binding FLII interacting protein 1
NCBI Official Symbol
LRRFIP1
NCBI Official Synonym Symbols
GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
NCBI Protein Information
leucine-rich repeat flightless-interacting protein 1

Research Articles on LRRFIP1

Similar Products

Product Notes

The LRRFIP1 (Catalog #AAA6384412) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LRRFIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LRRFIP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRFIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.