Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LRRC51 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Rabbit LRRC51 Polyclonal Antibody | anti-LRTOMT antibody

LRRC51 antibody - N-terminal region

Gene Names
LRTOMT; DFNB63; LRRC51; CFAP111
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LRRC51; Polyclonal Antibody; LRRC51 antibody - N-terminal region; anti-LRTOMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
Sequence Length
192
Applicable Applications for anti-LRTOMT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC51
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LRRC51 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-LRRC51 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-LRTOMT antibody
This is a rabbit polyclonal antibody against LRRC51. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of LRRC51 remains unknown.
Product Categories/Family for anti-LRTOMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
leucine-rich repeat-containing protein 51 isoform LRTOMT1a
NCBI Official Synonym Full Names
leucine rich transmembrane and O-methyltransferase domain containing
NCBI Official Symbol
LRTOMT
NCBI Official Synonym Symbols
DFNB63; LRRC51; CFAP111
NCBI Protein Information
transmembrane O-methyltransferase; leucine-rich repeat-containing protein 51
UniProt Protein Name
Leucine-rich repeat-containing protein 51
UniProt Gene Name
LRTOMT
UniProt Synonym Gene Names
LRRC51
UniProt Entry Name
LRC51_HUMAN

NCBI Description

This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centromere-distal 3' terminal exon (long transcript form) encode the LRTOMT2 protein. There is a small region within one of the exons of this gene that contains overlapping alternate reading frames for both LRTOMT1 and LRTOMT2. LRTOMT1 shares similarity with the protein encoded by mouse Lrrc51, while LRTOMT2 shares similarity with the protein encoded by mouse Tomt. Alternative splicing results in multiple transcript variants, encoding different isoforms of both LRTOMT1 and LRTOMT2. The LRTOMT1 protein is a leucine-rich repeat-containing protein, while the LRTOMT2 protein is a catechol-O-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to a hydroxyl group of catechols and is essential for auditory and vestibular function. Mutations in this gene have been associated with nonsyndromic deafness. [provided by RefSeq, Nov 2017]

Research Articles on LRTOMT

Similar Products

Product Notes

The LRTOMT lrtomt (Catalog #AAA3212239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRC51 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRRC51 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LRTOMT lrtomt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNKRDYMNTS VQEPPLDYSF RSIHVIQDLV NEEPRTGLRP LKRSKSGKSL. It is sometimes possible for the material contained within the vial of "LRRC51, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.