Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.)

Mouse LRRC8A Monoclonal Antibody | anti-LRRC8A antibody

LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (Biotin)

Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LRRC8A; Monoclonal Antibody; LRRC8A (Leucine Rich Repeat Containing 8 Family; Member A; FLJ10337; FLJ41617; KIAA1437; LRRC8) (Biotin); Leucine Rich Repeat Containing 8 Family; LRRC8; anti-LRRC8A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8H9
Specificity
Recognizes LRRC8A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
810
Applicable Applications for anti-LRRC8A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LRRC8A (NP_062540.2, 711aa-810aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.)

Western Blot (WB) (LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.)
Related Product Information for anti-LRRC8A antibody
This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-LRRC8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
volume-regulated anion channel subunit LRRC8A
UniProt Protein Name
Volume-regulated anion channel subunit LRRC8A
UniProt Gene Name
LRRC8A
UniProt Synonym Gene Names
KIAA1437; LRRC8; SWELL1
UniProt Entry Name
LRC8A_HUMAN

Uniprot Description

LRRC8A: Involved in B-cell development. Required for the pro-B cell to pre-B cell transition. Defects in LRRC8A are the cause of agammaglobulinemia type 5 (AGM5). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. A chromosomal aberration involving LRRC8 has been found in a patient with congenital agammaglobulinemia. Translocation t(9;20)(q33.2;q12). The translocation truncates the LRRC8 gene, resulting in deletion of the eighth, ninth, and half of the seventh LRR domains.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: cell surface; membrane; plasma membrane

Molecular Function: anion channel activity; protein binding; volume-sensitive anion channel activity

Biological Process: anion transport; cell volume homeostasis; pre-B cell differentiation; response to osmotic stress

Disease: Agammaglobulinemia 5, Autosomal Dominant

Similar Products

Product Notes

The LRRC8A lrrc8a (Catalog #AAA6174545) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LRRC8A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LRRC8A lrrc8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRC8A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.