Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit LRPAP1 Polyclonal Antibody | anti-LRPAP1 antibody

LRPAP1 antibody - C-terminal region

Gene Names
LRPAP1; RAP; MRAP; A2RAP; HBP44; MYP23; A2MRAP; alpha-2-MRAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
LRPAP1; Polyclonal Antibody; LRPAP1 antibody - C-terminal region; anti-LRPAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH
Sequence Length
357
Applicable Applications for anti-LRPAP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LRPAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-LRPAP1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-LRPAP1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-LRPAP1 antibody
This is a rabbit polyclonal antibody against LRPAP1. It was validated on Western Blot and immunohistochemistry

Target Description: LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.
Product Categories/Family for anti-LRPAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
alpha-2-macroglobulin receptor-associated protein
NCBI Official Synonym Full Names
LDL receptor related protein associated protein 1
NCBI Official Symbol
LRPAP1
NCBI Official Synonym Symbols
RAP; MRAP; A2RAP; HBP44; MYP23; A2MRAP; alpha-2-MRAP
NCBI Protein Information
alpha-2-macroglobulin receptor-associated protein
UniProt Protein Name
Alpha-2-macroglobulin receptor-associated protein
UniProt Gene Name
LRPAP1
UniProt Synonym Gene Names
A2MRAP; Alpha-2-MRAP; RAP
UniProt Entry Name
AMRP_HUMAN

NCBI Description

This gene encodes a protein that interacts with the low density lipoprotein (LDL) receptor-related protein and facilitates its proper folding and localization by preventing the binding of ligands. Mutations in this gene have been identified in individuals with myopia 23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

LRPAP1: Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330. In complex with the alpha-2-MR or gp330, it may have some role in the pathogenesis of membrane glomerular nephritis. Belongs to the alpha-2-MRAP family.

Protein type: Receptor, misc.

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: cell surface; endoplasmic reticulum; extracellular region; plasma membrane; integral to membrane; vesicle

Molecular Function: heparin binding; receptor antagonist activity; protein binding; low-density lipoprotein receptor binding; unfolded protein binding; asialoglycoprotein receptor activity

Biological Process: vesicle-mediated transport; receptor-mediated endocytosis; protein folding; negative regulation of protein binding

Disease: Myopia 23, Autosomal Recessive

Research Articles on LRPAP1

Similar Products

Product Notes

The LRPAP1 lrpap1 (Catalog #AAA3207705) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRPAP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRPAP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LRPAP1 lrpap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDLWDLAQSA NLTDKELEAF REELKHFEAK IEKHNHYQKQ LEIAHEKLRH. It is sometimes possible for the material contained within the vial of "LRPAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.