Western Blot (WB)
(LOC645339 antibody (MBS5301139) used at 1 ug/ml to detect target protein.)
Rabbit LOC645339 Polyclonal Antibody | anti-LOC645339 antibody
LOC645339 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
LOC645339; Polyclonal Antibody; LOC645339 antibody; Polyclonal LOC645339; Anti-LOC645339; LOC 645339; Hypothetical Loc645339; LOC-645339; anti-LOC645339 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
LOC645339 antibody was raised against the middle region of LOC645339
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC645339 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
55
Applicable Applications for anti-LOC645339 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of LOC645339 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
LOC645339 antibody was raised using the middle region of LOC645339 corresponding to a region with amino acids MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(LOC645339 antibody (MBS5301139) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(LOC645339 antibody (MBS5301139) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LOC645339 antibody
Rabbit polyclonal LOC645339 antibody raised against the middle region of LOC645339
Product Categories/Family for anti-LOC645339 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
6 kDa (MW of target protein)
NCBI Official Full Name
LOC645339 protein
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein D2 pseudogene 2
NCBI Official Symbol
SNRPD2P2
UniProt Protein Name
LOC645339 protein
UniProt Gene Name
LOC645339
UniProt Entry Name
Q4G1D0_HUMAN
Similar Products
Product Notes
The LOC645339 loc645339 (Catalog #AAA5301139) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LOC645339 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LOC645339 loc645339 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOC645339, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
