Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit LOC116236 Polyclonal Antibody | anti-LOC116236 antibody

LOC116236 antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
LOC116236; Polyclonal Antibody; LOC116236 antibody; Polyclonal LOC116236; Anti-LOC116236; LOC-116236; LOC 116236; Hypothetical Protein Loc116236; anti-LOC116236 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
LOC116236 antibody was raised against the middle region of LOC116236
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LOC116236 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-LOC116236 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of LOC116236 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
LOC116236 antibody was raised using the middle region of LOC116236 corresponding to a region with amino acids LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(LOC116236 antibody (MBS839432) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-LOC116236 antibody
Rabbit polyclonal LOC116236 antibody raised against the middle region of LOC116236
Product Categories/Family for anti-LOC116236 antibody

Similar Products

Product Notes

The LOC116236 (Catalog #AAA839432) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LOC116236 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LOC116236 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LOC116236 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOC116236, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual