Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LMAN2L expression in transfected 293T cell line by LMAN2L polyclonal antibody. Lane 1: LMAN2L transfected lysate (38.28kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human LMAN2L Polyclonal Antibody | anti-LMAN2L antibody

LMAN2L (VIP36-like Protein, Lectin Mannose-binding 2-like, LMAN2-like Protein, VIPL, PSEC0028, UNQ368/PRO704, DKFZp564L2423, MGC11139)

Gene Names
LMAN2L; VIPL
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LMAN2L; Polyclonal Antibody; LMAN2L (VIP36-like Protein; Lectin Mannose-binding 2-like; LMAN2-like Protein; VIPL; PSEC0028; UNQ368/PRO704; DKFZp564L2423; MGC11139); Anti -LMAN2L (VIP36-like Protein; anti-LMAN2L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LMAN2L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
Applicable Applications for anti-LMAN2L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LMAN2L, aa1-348 (NP_110432).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LMAN2L expression in transfected 293T cell line by LMAN2L polyclonal antibody. Lane 1: LMAN2L transfected lysate (38.28kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LMAN2L expression in transfected 293T cell line by LMAN2L polyclonal antibody. Lane 1: LMAN2L transfected lysate (38.28kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LMAN2L antibody
May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53.
Product Categories/Family for anti-LMAN2L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,711 Da
NCBI Official Full Name
LMAN2L protein, partial
NCBI Official Synonym Full Names
lectin, mannose-binding 2-like
NCBI Official Symbol
LMAN2L
NCBI Official Synonym Symbols
VIPL
NCBI Protein Information
VIP36-like protein; LMAN2-like protein
UniProt Protein Name
VIP36-like protein
Protein Family
UniProt Gene Name
LMAN2L
UniProt Synonym Gene Names
VIPL; LMAN2-like protein
UniProt Entry Name
LMA2L_HUMAN

Uniprot Description

LMAN2L: May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; integral to membrane; ER to Golgi transport vesicle

Molecular Function: mannose binding; metal ion binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; protein folding

Research Articles on LMAN2L

Similar Products

Product Notes

The LMAN2L lman2l (Catalog #AAA6005265) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMAN2L (VIP36-like Protein, Lectin Mannose-binding 2-like, LMAN2-like Protein, VIPL, PSEC0028, UNQ368/PRO704, DKFZp564L2423, MGC11139) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMAN2L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LMAN2L lman2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATLGPLGS WQQWRRCLSA RDGSRMLLLL LLLGSGQGPQ QVGAGQTFEY LKREHSLSKP YQGVGTGSSS LWNLMGNAMV MTQYIRLTPD MQSKQGALWN RVPCFLRDWE LQVHFKIHGQ GKKNLHGDGL AIWYTKDRMQ PGPVFGNMDK FVGLGVFVDT YPNEEKQQER VFPYISAMVN NGSLSYDHER DGRPTELGGC TAIVRNLHYD TFLVIRYVKR HLTIMMDIDG KHEWRDCIEV PGVRLPRGYY FGTSSITGDL SDNHDVISLK LFELTVERTP EEEKLHRDVF LPSVDNMKLP EMTAPLPPLS GLALFLIVFF SLVFSVFAIV IGIILYNKWQ EQSRKRFY. It is sometimes possible for the material contained within the vial of "LMAN2L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.