Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIPI Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)

Rabbit LIPI Polyclonal Antibody | anti-LIPI antibody

LIPI antibody - middle region

Gene Names
LIPI; CT17; LPDL; PLA1C; PRED5; mPA-PLA1 beta
Reactivity
Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIPI; Polyclonal Antibody; LIPI antibody - middle region; anti-LIPI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL
Sequence Length
481
Applicable Applications for anti-LIPI antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 93%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LIPI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIPI Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-LIPI Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)
Related Product Information for anti-LIPI antibody
This is a rabbit polyclonal antibody against LIPI. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. The encoded protein, which can be inhibited by sodium vanadate, may be found exclusively in sperm. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia.
Product Categories/Family for anti-LIPI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
lipase member I isoform 5
NCBI Official Synonym Full Names
lipase I
NCBI Official Symbol
LIPI
NCBI Official Synonym Symbols
CT17; LPDL; PLA1C; PRED5; mPA-PLA1 beta
NCBI Protein Information
lipase member I
UniProt Protein Name
Lipase member I
Protein Family
UniProt Gene Name
LIPI
UniProt Synonym Gene Names
LPDL; LIPI; CT17
UniProt Entry Name
LIPI_HUMAN

NCBI Description

The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia. This gene is also expressed at high levels in Ewing family tumor cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

LIPI: Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG). Defects in LIPI may be a cause of susceptibility to familial hypertriglyceridemia (FHTR)[MIM:145750]. Familial hypertriglyceridemia is a common inherited disorder in which the concentration of very low density lipoprotein (VLDL) is elevated in the plasma. This leads to increased risk of heart disease, obesity, and pancreatitis. Belongs to the AB hydrolase superfamily. Lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Phospholipase; Secreted; EC 3.1.1.-; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 21q11.2

Cellular Component: extracellular space; membrane; plasma membrane; extracellular region

Molecular Function: heparin binding; phospholipase activity

Biological Process: lipid catabolic process

Disease: Hypertriglyceridemia, Familial

Research Articles on LIPI

Similar Products

Product Notes

The LIPI lipi (Catalog #AAA3207979) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPI antibody - middle region reacts with Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LIPI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIPI lipi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFVLSIIVPD KTMMDGSFSF KLLNQLGMIE EPRLYEKNKP FYKLQEVKIL. It is sometimes possible for the material contained within the vial of "LIPI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.