Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIPH AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit LIPH Polyclonal Antibody | anti-LIPH antibody

LIPH antibody - C-terminal region

Gene Names
LIPH; AH; LAH2; ARWH2; HYPT7; LPDLR; PLA1B; mPA-PLA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LIPH; Polyclonal Antibody; LIPH antibody - C-terminal region; anti-LIPH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG
Sequence Length
451
Applicable Applications for anti-LIPH antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIPH AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-LIPH AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-LIPH antibody
This is a rabbit polyclonal antibody against LIPH. It was validated on Western Blot

Target Description: This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
Product Categories/Family for anti-LIPH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
lipase member H
NCBI Official Synonym Full Names
lipase H
NCBI Official Symbol
LIPH
NCBI Official Synonym Symbols
AH; LAH2; ARWH2; HYPT7; LPDLR; PLA1B; mPA-PLA1
NCBI Protein Information
lipase member H
UniProt Protein Name
Lipase member H
Protein Family
UniProt Gene Name
LIPH
UniProt Synonym Gene Names
LPDLR; MPAPLA1; PLA1B; LIPH
UniProt Entry Name
LIPH_HUMAN

NCBI Description

This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility. [provided by RefSeq, Jul 2008]

Uniprot Description

LIPH: Hydrolyzes specifically phosphatidic acid (PA) to produce 2-acyl lysophosphatidic acid (LPA; a potent bioactive lipid mediator) and fatty acid. Does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG). Defects in LIPH are the cause of hypotrichosis type 7 (HYPT7); also known as alopecia universalis congenita Mari type. A condition characterized by the presence of less than the normal amount of hair. Affected individuals have sparse or absent scalp, axillary and body hair and sparse eyebrows and eyelashes. Defects in LIPH are the cause of woolly hair autosomal recessive type 2 (ARWH2). A hair shaft disorder characterized by fine and tightly curled hair. Compared to normal curly hair that is observed in some populations, woolly hair grows slowly and stops growing after a few inches. Under light microscopy, woolly hair shows some structural anomalies, including trichorrhexis nodosa and tapered ends. Some individuals may present with hypotrichosis. Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: EC 3.1.1.-; Phospholipase; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space; plasma membrane

Molecular Function: heparin binding; phospholipase activity

Biological Process: lipid catabolic process

Disease: Hypotrichosis 7

Research Articles on LIPH

Similar Products

Product Notes

The LIPH liph (Catalog #AAA3215312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPH antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LIPH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LIPH liph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRESCTITAY PCDSYQDYRN GKCVSCGTSQ KESCPLLGYY ADNWKDHLRG. It is sometimes possible for the material contained within the vial of "LIPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.