Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Placenta)

Rabbit LIPG Polyclonal Antibody | anti-LIPG antibody

LIPG antibody - middle region

Gene Names
LIPG; EL; EDL; PRO719
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LIPG; Polyclonal Antibody; LIPG antibody - middle region; anti-LIPG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Sequence Length
500
Applicable Applications for anti-LIPG antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 82%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LIPG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Placenta)

Immunohistochemistry (IHC) (Placenta)

Western Blot (WB)

(WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-LIPG antibody
This is a rabbit polyclonal antibody against LIPG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
endothelial lipase isoform 1
NCBI Official Synonym Full Names
lipase G, endothelial type
NCBI Official Symbol
LIPG
NCBI Official Synonym Symbols
EL; EDL; PRO719
NCBI Protein Information
endothelial lipase
UniProt Protein Name
Endothelial lipase
Protein Family
UniProt Gene Name
LIPG
UniProt Synonym Gene Names
EDL; EL
UniProt Entry Name
LIPE_HUMAN

NCBI Description

The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. [provided by RefSeq, Jul 2008]

Uniprot Description

LIPG: Has phospholipase and triglyceride lipase activities. Hydrolyzes high density lipoproteins (HDL) more efficiently than other lipoproteins. Binds heparin. Belongs to the AB hydrolase superfamily. Lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerolipid; Phospholipase; Secreted; EC 3.1.1.3; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: Golgi apparatus; extracellular space; cell surface; early endosome

Molecular Function: heparin binding; lipoprotein lipase activity; phospholipase A1 activity; phospholipase activity

Biological Process: cell proliferation; cholesterol homeostasis; reverse cholesterol transport; phospholipid catabolic process; regulation of lipoprotein metabolic process; lipid metabolic process; positive regulation of cholesterol transport; response to nutrient; phospholipid homeostasis

Research Articles on LIPG

Similar Products

Product Notes

The LIPG lipg (Catalog #AAA3200274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIPG antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's LIPG can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LIPG lipg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKSGETQRKL TFCTEDPENT SISPGRELWF RKCRDGWRMK NETSPTVELP. It is sometimes possible for the material contained within the vial of "LIPG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.