Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse testis, using LIN9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Rabbit anti-Human, Mouse LIN9 Polyclonal Antibody | anti-LIN9 antibody

LIN9 Rabbit pAb

Gene Names
LIN9; TGS; BARA; TGS1; TGS2; Lin-9; BARPsv
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
LIN9; Polyclonal Antibody; LIN9 Rabbit pAb; BARA; BARPsv; Lin-9; TGS; TGS1; TGS2; anti-LIN9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPC
Applicable Applications for anti-LIN9 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human LIN9 (NP_775106.2).
Positive Samples
Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse testis, using LIN9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse testis, using LIN9 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Related Product Information for anti-LIN9 antibody
Background: This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell cycle-dependent gene expression in non-dividing cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Product Categories/Family for anti-LIN9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
61,946 Da
NCBI Official Full Name
LIN9 protein, partial
NCBI Official Synonym Full Names
lin-9 homolog (C. elegans)
NCBI Official Symbol
LIN9
NCBI Official Synonym Symbols
TGS; BARA; TGS1; TGS2; Lin-9; BARPsv
NCBI Protein Information
protein lin-9 homolog; pRB-associated protein; rb related pathway actor; TUDOR gene similar protein; beta subunit-associated regulator of apoptosis; type I interferon receptor beta chain-associated protein
UniProt Protein Name
Protein lin-9 homolog
Protein Family
UniProt Gene Name
LIN9
UniProt Synonym Gene Names
BARA; TGS; HuLin-9; hLin-9
UniProt Entry Name
LIN9_HUMAN

NCBI Description

This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell cycle-dependent gene expression in non-dividing cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

LIN9: a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition. Component of the DREAM complex composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBBP4, RBL2, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with RB1. Three alternative spliced human isoforms have been reported.

Protein type: Cell cycle regulation; Transcription, coactivator/corepressor; Tumor suppressor

Chromosomal Location of Human Ortholog: 1q42.12

Cellular Component: nucleoplasm; transcriptional repressor complex

Molecular Function: protein binding

Biological Process: transcription, DNA-dependent; regulation of cell cycle; mitotic cell cycle; G2/M transition of mitotic cell cycle

Research Articles on LIN9

Similar Products

Product Notes

The LIN9 lin9 (Catalog #AAA9143069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIN9 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LIN9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the LIN9 lin9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLGGFPVEFL IQVTRLSKIL MIKKEHIKKL REMNTEAEKL KSYSMPISIE FQRRYATIVL ELEQLNKDLN KVLHKVQQYC YELAPDQGLQ PADQPTDMRR RCEEEAQEIV RHANSSTGQP C. It is sometimes possible for the material contained within the vial of "LIN9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.