Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LIG3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Rabbit LIG3 Polyclonal Antibody | anti-LIG3 antibody

LIG3 Polyclonal Antibody

Gene Names
LIG3; LIG2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
LIG3; Polyclonal Antibody; LIG3 Polyclonal Antibody; LIG2; anti-LIG3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
AGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDK
Sequence Length
949
Applicable Applications for anti-LIG3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human LIG3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion, Mitochondrion, Nucleus
Positive Samples
HT-29, BT-474, SW480
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using LIG3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using LIG3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat heart using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat heart using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human oophoroma using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human oophoroma using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human esophageal cancer using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse heart using LIG3 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse heart using LIG3 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-LIG3 antibody
This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-LIG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 95kDa; 102kDa; 106kDa; 112kDa
Observed: 112kDa
NCBI Official Full Name
DNA ligase 3 isoform beta
NCBI Official Synonym Full Names
DNA ligase 3
NCBI Official Symbol
LIG3
NCBI Official Synonym Symbols
LIG2
NCBI Protein Information
DNA ligase 3
UniProt Protein Name
DNA ligase 3
Protein Family
UniProt Gene Name
LIG3

NCBI Description

This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Isoform 3 functions as heterodimer with DNA-repair protein XRCC1 in the nucleus and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents. Isoform 1 is targeted to mitochondria, where it functions as DNA ligase in mitochondrial base-excision DNA repair (PubMed:10207110, PubMed:24674627).

Research Articles on LIG3

Similar Products

Product Notes

The LIG3 lig3 (Catalog #AAA9133547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIG3 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LIG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the LIG3 lig3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGGHDDATLA RLQNELDMVK ISKDPSKIPS WLKVNKIYYP DFIVPDPKKA AVWEITGAEF SKSEAHTADG ISIRFPRCTR IRDDKDWKSA TNLPQLKELY QLSKEKADFT VVAGDEGSST TGGSSEENKG PSGSAVSRKA PSKPSASTKK AEGKLSNSNS KDGNMQTAKP SAMKVGEKLA TKSSPVKVGE KRKAADETLC QTKVLLDIFT GVRLYLPPST PDFSRLRRYF VAFDGDLVQE FDMTSATHVL GSRDK. It is sometimes possible for the material contained within the vial of "LIG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.