Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LHX8 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit LHX8 Polyclonal Antibody | anti-LHX8 antibody

LHX8 antibody - middle region

Gene Names
LHX8; LHX7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
LHX8; Polyclonal Antibody; LHX8 antibody - middle region; anti-LHX8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVN
Sequence Length
356
Applicable Applications for anti-LHX8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LHX8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LHX8 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-LHX8 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-LHX8 antibody
This is a rabbit polyclonal antibody against LHX8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LHX8 is a member of the LIM homeobox family. Members of this family share common structural features. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, in addition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulating the activity of these molecules by interacting with other proteins. Members of the family are required for the patterning or the specification and differentiation of different cell types during embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
LIM/homeobox protein Lhx8 isoform 1
NCBI Official Synonym Full Names
LIM homeobox 8
NCBI Official Symbol
LHX8
NCBI Official Synonym Symbols
LHX7
NCBI Protein Information
LIM/homeobox protein Lhx8
UniProt Protein Name
LIM/homeobox protein Lhx8
Protein Family
UniProt Gene Name
LHX8
UniProt Synonym Gene Names
LIM homeobox protein 8
UniProt Entry Name
LHX8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the LIM homeobox family of proteins, which are involved in patterning and differentiation of various tissue types. These proteins contain two tandemly repeated cysteine-rich double-zinc finger motifs known as LIM domains, in addition to a DNA-binding homeodomain. This family member is a transcription factor that plays a role in tooth morphogenesis. It is also involved in oogenesis and in neuronal differentiation. This gene is a candidate gene for cleft palate, and it is also associated with odontoma formation. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

LHX8: Transcription factor involved in differentiation of certain neurons and mesenchymal cells.

Protein type: DNA-binding; Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1p31.1

Cellular Component: female germ cell nucleus

Molecular Function: zinc ion binding; sequence-specific DNA binding

Biological Process: learning and/or memory; regulation of transcription, DNA-dependent; transcription, DNA-dependent; forebrain neuron development; female gonad development; odontogenesis of dentine-containing teeth

Research Articles on LHX8

Similar Products

Product Notes

The LHX8 lhx8 (Catalog #AAA3208597) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHX8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LHX8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LHX8 lhx8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSTGEEFALV EEKVLCRVHY DCMLDNLKRE VENGNGISVE GALLTEQDVN. It is sometimes possible for the material contained within the vial of "LHX8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.