Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using LHX8 antibody.)
Rabbit anti-Human LHX8 Polyclonal Antibody | anti-LHX8 antibody
LHX8 Polyclonal Antibody
Gene Names
LHX8; LHX7
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
LHX8; Polyclonal Antibody; LHX8 Polyclonal Antibody; LHX7; anti-LHX8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MQILSRCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVN
Sequence Length
356
Applicable Applications for anti-LHX8 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human LHX8
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using LHX8 antibody.)
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using LHX8 antibody.)
Related Product Information for anti-LHX8 antibody
The protein encoded by this gene is a member of the LIM homeobox family of proteins, which are involved in patterning and differentiation of various tissue types. These proteins contain two tandemly repeated cysteine-rich double-zinc finger motifs known as LIM domains, in addition to a DNA-binding homeodomain. This family member is a transcription factor that plays a role in tooth morphogenesis. It is also involved in oogenesis and in neuronal differentiation. This gene is a candidate gene for cleft palate, and it is also associated with odontoma formation. Alternative splicing of this gene results in multiple transcript variants.
Product Categories/Family for anti-LHX8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38kDa/39kDa
NCBI Official Full Name
LIM/homeobox protein Lhx8 isoform 1
NCBI Official Synonym Full Names
LIM homeobox 8
NCBI Official Symbol
LHX8
NCBI Official Synonym Symbols
LHX7
NCBI Protein Information
LIM/homeobox protein Lhx8
UniProt Protein Name
LIM/homeobox protein Lhx8
Protein Family
UniProt Gene Name
LHX8
UniProt Synonym Gene Names
LIM homeobox protein 8
NCBI Description
The protein encoded by this gene is a member of the LIM homeobox family of proteins, which are involved in patterning and differentiation of various tissue types. These proteins contain two tandemly repeated cysteine-rich double-zinc finger motifs known as LIM domains, in addition to a DNA-binding homeodomain. This family member is a transcription factor that plays a role in tooth morphogenesis. It is also involved in oogenesis and in neuronal differentiation. This gene is a candidate gene for cleft palate, and it is also associated with odontoma formation. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Uniprot Description
Transcription factor involved in differentiation of certain neurons and mesenchymal cells.
Research Articles on LHX8
Similar Products
Product Notes
The LHX8 lhx8 (Catalog #AAA9133495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHX8 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LHX8 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the LHX8 lhx8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQILSRCQGL MSEECGRTTA LAAGRTRKGA GEEGLVSPEG AGDEDSCSSS APLSPSSSPR SMASGSGCPP GKCVCNSCGL EIVDKYLLKV NDLCWHVRCL SCSVCRTSLG RHTSCYIKDK DIFCKLDYFR RYGTRCSRCG RHIHSTDWVR RAKGNVYHLA CFACFSCKRQ LSTGEEFALV EEKVLCRVHY DCMLDNLKRE VENGNGISVE GALLTEQDVN. It is sometimes possible for the material contained within the vial of "LHX8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
