Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit LEXM Polyclonal Antibody | anti-LEXM antibody

LEXM Antibody - middle region

Gene Names
LEXM; LEM; C1orf177
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LEXM; Polyclonal Antibody; LEXM Antibody - middle region; anti-LEXM antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN
Sequence Length
414
Applicable Applications for anti-LEXM antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C1orf177
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C1orf177 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Related Product Information for anti-LEXM antibody
This is a rabbit polyclonal antibody against C1orf177. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-LEXM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
lymphocyte expansion molecule isoform 1
NCBI Official Synonym Full Names
lymphocyte expansion molecule
NCBI Official Symbol
LEXM
NCBI Official Synonym Symbols
LEM; C1orf177
NCBI Protein Information
lymphocyte expansion molecule
UniProt Protein Name
Uncharacterized protein C1orf177
UniProt Gene Name
C1orf177
UniProt Entry Name
CA177_HUMAN

Research Articles on LEXM

Similar Products

Product Notes

The LEXM c1orf177 (Catalog #AAA3211111) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LEXM Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LEXM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LEXM c1orf177 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSMQKKKPRE LMNFKSFVEE LNSHHNKKHG VFSKLPRNPK TPTERIYWAN. It is sometimes possible for the material contained within the vial of "LEXM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual